BYKdb

Annotate results for A0A1C0AIE6

A0A1C0AIE6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C0AIE6
DOMAINtad1/129MQIVRRYWRSTLATVFLCIALAAGFTVLQSPTYTATSSVFISVESGGTAGELSQGATYAE
RQVGSFISVATSAMVLQPVIDELVLDLSVKELAEKLSVSSPSATSIIKVSADDESAQRSA
DLANAVAAS
DOMAINcd264/449TSSVDSEGKTETATNLARVLALAGERVLLIDADLRRPAVGERLRIDSELGLSDVLTGRGS
LHDLIIAMPPGHLSVLPAGTVPPNPSELLGSEAMQHLLATVERQYDYVLLDAPPLLPVTD
AVILAAQTGGAVVVSRSGSVRRQQLATALSALESADATLLGVVLNDVPSLRADSYGYYTP
TKVQPV
SITEWalker A271/273GKT
SITEWalker A'291/298LLIDADLR
SITEWalker B371/377VLLDAPP
SITE-368/-370YDY
SITEY Cluster438/441YGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQIVRRYWRSTLATVFLCIALAAGFTVLQSPTYTATSSVFISVESGGTAGELSQGATYAERQVGSFISVATSAMVLQPVI
MQIVRRYWRSTLATVFLCIALAAGFTVLQSPTYTATSSVFISVESGGTAGELSQGATYAERQVGSFISVATSAMVLQPVI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DELVLDLSVKELAEKLSVSSPSATSIIKVSADDESAQRSADLANAVAASLQRSTEELAPPGPDGNRLVSATIIDQAVVPE
DELVLDLSVKELAEKLSVSSPSATSIIKVSADDESAQRSADLANAVAAS                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPSAPLPGMNLALGGLLGLLLGFGQAVLRTVLDTRVRTTEDVADLTDAPVLAAIEHHEPSHVANRAATAGGGVQWASAEA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YRKLRTSIGFVGLGGERRSSMVITSSVDSEGKTETATNLARVLALAGERVLLIDADLRRPAVGERLRIDSELGLSDVLTG
                       TSSVDSEGKTETATNLARVLALAGERVLLIDADLRRPAVGERLRIDSELGLSDVLTG
                              GKT                 LLIDADLR                      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGSLHDLIIAMPPGHLSVLPAGTVPPNPSELLGSEAMQHLLATVERQYDYVLLDAPPLLPVTDAVILAAQTGGAVVVSRS
RGSLHDLIIAMPPGHLSVLPAGTVPPNPSELLGSEAMQHLLATVERQYDYVLLDAPPLLPVTDAVILAAQTGGAVVVSRS
                                                  VLLDAPP                       
       410       420       430       440         
....:....|....:....|....:....|....:....|....:....
GSVRRQQLATALSALESADATLLGVVLNDVPSLRADSYGYYTPTKVQPV
GSVRRQQLATALSALESADATLLGVVLNDVPSLRADSYGYYTPTKVQPV
                                     YGYY        
© 1998-2019