BYKdb

Annotate results for A0A1C0BIN1

A0A1C0BIN1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C0BIN1
DOMAINcd35/222TSSLDAEGKSTTSVNLAKSLAQQVDIKVLLIDSDLRRPKIHEYFGLENTVGLTNYLGNMC
GVKDVTRPTEEPNLSVICSGVAVPNPSELLASSAMKNLLACLEPYYDYIIMDTSPVNIVV
DALPLAKISDGVIIVVRDGISTYPELTKTVETLKMAEAKILGIILNGMKPEPRDCRYRYD
RYGKTCEP
SITE-217/-219GKT
SITEWalker A'63/70LLIDSDLR
SITEWalker B143/149IIMDTSP
SITE-139/-142YYDY
SITEY Cluster211/216YRYDRY
SITE-152/-158IVVDALP
SITEWalker A42/44GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDPSLTFQVTEAYKVARTSLAFSLLKKGCKKVIVTSSLDAEGKSTTSVNLAKSLAQQVDIKVLLIDSDLRRPKIHEYFGL
                                  TSSLDAEGKSTTSVNLAKSLAQQVDIKVLLIDSDLRRPKIHEYFGL
                                         GKS                  LLIDSDLR          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENTVGLTNYLGNMCGVKDVTRPTEEPNLSVICSGVAVPNPSELLASSAMKNLLACLEPYYDYIIMDTSPVNIVVDALPLA
ENTVGLTNYLGNMCGVKDVTRPTEEPNLSVICSGVAVPNPSELLASSAMKNLLACLEPYYDYIIMDTSPVNIVVDALPLA
                                                              IIMDTSP           
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
KISDGVIIVVRDGISTYPELTKTVETLKMAEAKILGIILNGMKPEPRDCRYRYDRYGKTCEPCP
KISDGVIIVVRDGISTYPELTKTVETLKMAEAKILGIILNGMKPEPRDCRYRYDRYGKTCEP  
                                                  YRYDRY        
© 1998-2019