BYKdb

Annotate results for A0A1C0Y7Z1

A0A1C0Y7Z1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C0Y7Z1
DOMAINcd57/239TSSSPGEGKSTNSANIAAVYAQGGKRVLLVDADMRKPTVHHTFNLKNTKGLSNLLTHQIT
MSEAVHETEQENLFVMTSGPIPPNPAELLASKSMNQFILDVTAAYDFVIFDVPPVLSVTD
AQILSNRCDGTVLVVNAGEADKAMVQKAKEALVASKANILGVILNNYVLERDHYYYQYYG
QPE
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDADMR
SITEWalker B164/170VIFDVPP
SITEY Cluster230/235YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNKKKKQRAKRTPSTLARKLITIESPKAIVSEQFRTIRTNISFSNPDKEIKSVIVTSSSPGEGKSTNSANIAAVYAQGG
                                                        TSSSPGEGKSTNSANIAAVYAQGG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLVDADMRKPTVHHTFNLKNTKGLSNLLTHQITMSEAVHETEQENLFVMTSGPIPPNPAELLASKSMNQFILDVTAA
KRVLLVDADMRKPTVHHTFNLKNTKGLSNLLTHQITMSEAVHETEQENLFVMTSGPIPPNPAELLASKSMNQFILDVTAA
   LLVDADMR                                                                     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
YDFVIFDVPPVLSVTDAQILSNRCDGTVLVVNAGEADKAMVQKAKEALVASKANILGVILNNYVLERDHYYYQYYGQPE
YDFVIFDVPPVLSVTDAQILSNRCDGTVLVVNAGEADKAMVQKAKEALVASKANILGVILNNYVLERDHYYYQYYGQPE
   VIFDVPP                                                           YYYQYY    
© 1998-2019