BYKdb

Annotate results for A0A1C0YM54

A0A1C0YM54 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C0YM54
DOMAINcd57/242TSSSPGEGKSTTSANVASVYAQEGKRVLLVDGDMRKPTVHHTFGLKNTKGLSNVLTRQVS
IEEAIQPSTLDNLSIMTSGPIPPNPAELLASKSMEQLIGELTAQYDFVIFDAPPILSVTD
SQILSNRCDGTVLVVKAGEAEKAMVQKAKESLVASQANILGVVLNNFVLAKDNYYYYQYY
GQAESN
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDGDMR
SITEWalker B164/170VIFDAPP
SITEY Cluster230/236YYYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFFKKKKKSKKRTTATLARKLITVENPKAIVSEQFRTLRTNINFSNPDKVLKTILVTSSSPGEGKSTTSANVASVYAQEG
                                                        TSSSPGEGKSTTSANVASVYAQEG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLVDGDMRKPTVHHTFGLKNTKGLSNVLTRQVSIEEAIQPSTLDNLSIMTSGPIPPNPAELLASKSMEQLIGELTAQ
KRVLLVDGDMRKPTVHHTFGLKNTKGLSNVLTRQVSIEEAIQPSTLDNLSIMTSGPIPPNPAELLASKSMEQLIGELTAQ
   LLVDGDMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDFVIFDAPPILSVTDSQILSNRCDGTVLVVKAGEAEKAMVQKAKESLVASQANILGVVLNNFVLAKDNYYYYQYYGQAE
YDFVIFDAPPILSVTDSQILSNRCDGTVLVVKAGEAEKAMVQKAKESLVASQANILGVVLNNFVLAKDNYYYYQYYGQAE
   VIFDAPP                                                           YYYYQYY    
  
..
SN
SN

© 1998-2019