BYKdb

Annotate results for A0A1C0ZRK7

A0A1C0ZRK7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C0ZRK7
DOMAINcd46/229TSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLRKPTMHHTLRVSNRWGLTNLLTNQLS
IQEVLQDTFIPNLHIISSGPIPPNPSEILASKKMLSVIEELKLQFDVILIDAPPAIAVTD
SQIIATRADGVILVVNSDKTKRDAVLKAKQNLDNVRARILGVILNNVDRKNKDAYYYYYY
GETQ
SITEWalker A53/55GKS
SITEWalker A'73/80LIIDGDLR
SITEWalker B153/159ILIDAPP
SITEY Cluster220/225YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNSTNKRPIITHQNPKSPISEAYRALRTNIQFSSIDEELKVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLR
                                             TSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLR
                                                    GKS                 LIIDGDLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTMHHTLRVSNRWGLTNLLTNQLSIQEVLQDTFIPNLHIISSGPIPPNPSEILASKKMLSVIEELKLQFDVILIDAPPA
KPTMHHTLRVSNRWGLTNLLTNQLSIQEVLQDTFIPNLHIISSGPIPPNPSEILASKKMLSVIEELKLQFDVILIDAPPA
                                                                        ILIDAPP 
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
IAVTDSQIIATRADGVILVVNSDKTKRDAVLKAKQNLDNVRARILGVILNNVDRKNKDAYYYYYYGETQ
IAVTDSQIIATRADGVILVVNSDKTKRDAVLKAKQNLDNVRARILGVILNNVDRKNKDAYYYYYYGETQ
                                                           YYYYYY    
© 1998-2019