BYKdb

Annotate results for A0A1C0ZSF7

A0A1C0ZSF7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C0ZSF7
DOMAINcd55/236TSAQPAEGKSTTAANLSVAYAQEGKKVLLIDADLRKPTIHHYFAKSNRYGLTSTLANQTE
IEEVIFKTTVENLFIITSGPIPPNPSELLMSQKMTALLADMATQFDMIIIDSPPTLAVAD
AQILATKCDGVVMVISEGKVKRDVARKAIENLERVQAKILGVVLNNKRHKKSDVSYNYYY
GQ
SITEWalker A62/64GKS
SITEWalker A'82/89LLIDADLR
SITEWalker B162/168IIIDSPP
SITEY Cluster230/234YNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTLTNKTSKADKAVSHQLITDIRPKSQVSEAYRTLRTNIQFSSIDHMMKTVLITSAQPAEGKSTTAANLSVAYAQEGKK
                                                      TSAQPAEGKSTTAANLSVAYAQEGKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLIDADLRKPTIHHYFAKSNRYGLTSTLANQTEIEEVIFKTTVENLFIITSGPIPPNPSELLMSQKMTALLADMATQFD
VLLIDADLRKPTIHHYFAKSNRYGLTSTLANQTEIEEVIFKTTVENLFIITSGPIPPNPSELLMSQKMTALLADMATQFD
 LLIDADLR                                                                       
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
MIIIDSPPTLAVADAQILATKCDGVVMVISEGKVKRDVARKAIENLERVQAKILGVVLNNKRHKKSDVSYNYYYGQ
MIIIDSPPTLAVADAQILATKCDGVVMVISEGKVKRDVARKAIENLERVQAKILGVVLNNKRHKKSDVSYNYYYGQ
 IIIDSPP                                                             YNYYY  
© 1998-2019