BYKdb

Annotate results for A0A1C2B334

A0A1C2B334 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C2B334
DOMAINcd59/247TSASVAEGKTTTAINVAASLAEYGHRVVLVDADLRRPTVAKRLSLNNSIGLTDFLIGQGD
LPDLLQQGGLDRLDVLATGQLPPNPAELLGSSRARELFDTLAASYDYVIVDTPPILPVSD
GAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDASDRAGAYHNTYYG
DTDTPRMAS
SITEWalker A66/68GKT
SITEWalker A'86/93VLVDADLR
SITEWalker B166/172VIVDTPP
SITE-163/-165YDY
SITEY Cluster232/237YHNTYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGVVDSPVIGLVPGDSALDGEGFVDFGAGGSVIAESYRRIRTNLAFAAVDPASRRILVTSASVAEGKTTTAINVAASLAE
                                                          TSASVAEGKTTTAINVAASLAE
                                                                 GKT            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGHRVVLVDADLRRPTVAKRLSLNNSIGLTDFLIGQGDLPDLLQQGGLDRLDVLATGQLPPNPAELLGSSRARELFDTLA
YGHRVVLVDADLRRPTVAKRLSLNNSIGLTDFLIGQGDLPDLLQQGGLDRLDVLATGQLPPNPAELLGSSRARELFDTLA
     VLVDADLR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASYDYVIVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDASDRAGAYHNTYYGDT
ASYDYVIVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWKATNVRLVGVVVNDASDRAGAYHNTYYGDT
     VIVDTPP                                                           YHNTYY   
       250       260  
....:....|....:....|..
DTPRMASQRSRSHDIAQVGLRR
DTPRMAS               

© 1998-2019