BYKdb

Annotate results for A0A1C2DCN8

A0A1C2DCN8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C2DCN8
DOMAINtad21/203DFIDLDALLAAARRQARLAGLFALAGLILGVAYLVVTPPQYTASTRILLDDSLTRFAQDK
QPTQAGTQADSMVLSEVEILKSSRLARAVVVAEKLQANEAFLNPPRSPLGWLKSTAKSLA
GFFSSGSEDEPGSVENAKIGRAIGLLQDGLNAERVGRSLVIDLSFTASDPKLAGSIARAY
ANA
DOMAINcd577/767VSVLPREGKTTVAANFAGLLAANGSRTLLIDADLRNPGLSRGLSLTPDKGLVEALVGEQR
WQSACLVDRKTKLVILPAVVRRRMSHTSELISGPAMASLIEEARKSFDYVVVDLPPLGPV
VDAKAFAPLADGFVLVAEWGATPRVLVRSALQADRQIAAKTLGVVLNRTDMKKLAHYGLF
GGAEHYLDRYA
SITEWalker A584/586GKT
SITEWalker A'604/611LLIDADLR
SITEWalker B686/692VVVDLPP
SITEY Cluster762/770YLDRYASYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQGSFPLNNRVPMPPEARSDFIDLDALLAAARRQARLAGLFALAGLILGVAYLVVTPPQYTASTRILLDDSLTRFAQDK
                    DFIDLDALLAAARRQARLAGLFALAGLILGVAYLVVTPPQYTASTRILLDDSLTRFAQDK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPTQAGTQADSMVLSEVEILKSSRLARAVVVAEKLQANEAFLNPPRSPLGWLKSTAKSLAGFFSSGSEDEPGSVENAKIG
QPTQAGTQADSMVLSEVEILKSSRLARAVVVAEKLQANEAFLNPPRSPLGWLKSTAKSLAGFFSSGSEDEPGSVENAKIG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAIGLLQDGLNAERVGRSLVIDLSFTASDPKLAGSIARAYANAYLSDHLDANFDATQRATVWLQGRLDELRQNSQKAALE
RAIGLLQDGLNAERVGRSLVIDLSFTASDPKLAGSIARAYANA                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEQFRTAHGLTAASGQLMSDQQLSDLNKQLILAQADTANAFARYNQFKSIVDSGSDNAVKNATIPQEKGAGGNNSSVIND


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSRYLNISKREQDISSRFGQDHPQAVALRREQADLTNQIFAELQRLTESYRNEYQVAKSREDSLRSNVGDLAGQNSQTS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAQVELRDLEQKSQALNTLYQSFLSRYQEASQQRSFPIAEARVISQAGNPVSASSPRKAMVLGLSVVLGLFAGALAGAVQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFRERFFRTGEDVRDVLDLNFLGYLPAIGGQYADARPRAQPAEDDTARPASAETVTPRILRVAINQPASSFAETLRSVKL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASDVVLHRTAGKVIGFVSVLPREGKTTVAANFAGLLAANGSRTLLIDADLRNPGLSRGLSLTPDKGLVEALVGEQRWQSA
                VSVLPREGKTTVAANFAGLLAANGSRTLLIDADLRNPGLSRGLSLTPDKGLVEALVGEQRWQSA
                       GKT                 LLIDADLR                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CLVDRKTKLVILPAVVRRRMSHTSELISGPAMASLIEEARKSFDYVVVDLPPLGPVVDAKAFAPLADGFVLVAEWGATPR
CLVDRKTKLVILPAVVRRRMSHTSELISGPAMASLIEEARKSFDYVVVDLPPLGPVVDAKAFAPLADGFVLVAEWGATPR
                                             VVVDLPP                            
       730       740       750       760       770       780      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
VLVRSALQADRQIAAKTLGVVLNRTDMKKLAHYGLFGGAEHYLDRYASYYVEQTVAEPDPKRMETA
VLVRSALQADRQIAAKTLGVVLNRTDMKKLAHYGLFGGAEHYLDRYA                   
                                         YLDRYASYY                

© 1998-2019