BYKdb

Annotate results for A0A1C2G545

A0A1C2G545 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C2G545
DOMAINcd57/248TSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPTLHATFNKSNQRGLTTILTSGTN
SVDLREIIQASGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTVEGIYDMVIIDVPPMLE
VTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDISADGDAGYGY
GYGYGYGYGEET
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDSDLR
SITEWalker B167/173VIIDVPP
SITEY Cluster234/244YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFHRTQKQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
                                                        TSANVSEGKSTVTDNVAVVWAQTG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKVLLIDSDLRRPTLHATFNKSNQRGLTTILTSGTNSVDLREIIQASGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
QKVLLIDSDLRRPTLHATFNKSNQRGLTTILTSGTNSVDLREIIQASGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
   LLIDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGIYDMVIIDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDISADGDAGYGYGYGY
EGIYDMVIIDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDISADGDAGYGYGYGY
      VIIDVPP                                                            YGYGYGY
       250
....:....|
GYGYGEETSK
GYGYGEET  
GYGY      
© 1998-2019