BYKdb

Annotate results for A0A1C2HZA7

A0A1C2HZA7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C2HZA7
DOMAINtad34/289EKIDLSALLRSLKRHWRLPLELAGVGAVLAILITLFSVPVFESSGSVYLGNAEKDQAAVS
AATEGLSLVPGLVQAPNLETQVQIMQSRQVVERAIVRSGVNVSILNPDQSPVVHFWYWLV
SGHSFNIYEHQKTGLRATLAEAVNPDIYGKSLDLKFTKDGHYQIFDDKNLILNGVLDEPA
VSPNLRIIIKPDAQGFIPGNNSIYHLTVSSPLAVYKEFAGNISVSQDSKDNGGTPTLSYL
IYLSFKNPNPYVSQRF
DOMAINcd637/827SSAFQGDGKTTVVSQLAVALAKDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAK
LEDCTRVMTRFDVPLTCLPSGQTPDSPVELIGKERFAELIDKARSEYDYVLIDTPPFPVL
SDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALLINGAPTSQGGVYHYHP
RSSVRLDLENR
SITEWalker A644/646GKT
SITEWalker A'664/671LLIDADLR
SITEWalker B746/752VLIDTPP
SITE-743/-745YDY
SITEY Cluster812/814YHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDHTENMHPSENVDLQRRPSIANNSERMGDEGEKIDLSALLRSLKRHWRLPLELAGVGAVLAILITLFSVPVFESSGSV
                                 EKIDLSALLRSLKRHWRLPLELAGVGAVLAILITLFSVPVFESSGSV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLGNAEKDQAAVSAATEGLSLVPGLVQAPNLETQVQIMQSRQVVERAIVRSGVNVSILNPDQSPVVHFWYWLVSGHSFNI
YLGNAEKDQAAVSAATEGLSLVPGLVQAPNLETQVQIMQSRQVVERAIVRSGVNVSILNPDQSPVVHFWYWLVSGHSFNI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YEHQKTGLRATLAEAVNPDIYGKSLDLKFTKDGHYQIFDDKNLILNGVLDEPAVSPNLRIIIKPDAQGFIPGNNSIYHLT
YEHQKTGLRATLAEAVNPDIYGKSLDLKFTKDGHYQIFDDKNLILNGVLDEPAVSPNLRIIIKPDAQGFIPGNNSIYHLT

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSSPLAVYKEFAGNISVSQDSKDNGGTPTLSYLIYLSFKNPNPYVSQRFLNSLMLSYLEQTHAWATGQASSTYDYLNGQL
VSSPLAVYKEFAGNISVSQDSKDNGGTPTLSYLIYLSFKNPNPYVSQRF                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKVRTALATADGKLARYQSHSGLLSVTSNAQAMITQMTNYESQRNALDLKLKNLQQVSSELSGKGGSHVDSYLVTSLNDS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLNSLSDKLVTAQNRKASLATMYTDRAPEIQQLDKEIASIRSAISSVIHNQEVQTQQQLKSLDGAIEQYKGKMGQYPREA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQVLSLTRSTEVLGKLYMFLLEKQKEAAISRASTITKNRILDTALVHSVPVSPKASKAVLIGAFLGLLLGLAVVFARFLL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKGFHSDEGILSRYPSIPLFGKLPEYEAFQSVGDSAKIKPIVPSDPRSTYGEALRLLRGKLYLDSGAGNAGKVLMFSSAF
                                                                            SSAF

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGDGKTTVVSQLAVALAKDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAKLEDCTRVMTRFDVPLTCLPSGQTP
QGDGKTTVVSQLAVALAKDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAKLEDCTRVMTRFDVPLTCLPSGQTP
   GKT                 LLIDADLR                                                 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSPVELIGKERFAELIDKARSEYDYVLIDTPPFPVLSDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALL
DSPVELIGKERFAELIDKARSEYDYVLIDTPPFPVLSDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALL
                         VLIDTPP                                                
       810       820       830         
....:....|....:....|....:....|....:....
INGAPTSQGGVYHYHPRSSVRLDLENRVRSFISQFQRKR
INGAPTSQGGVYHYHPRSSVRLDLENR            
           YHY                         

© 1998-2019