BYKdb

Annotate results for A0A1C2JGD0

A0A1C2JGD0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C2JGD0
DOMAINcd140/329SSAFQGDGKTTVVSQLAVALAKDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAK
LEDCTRVMTRFDVPLTCLPSGQTPDSPVELIGKERFAELIDKARSEYDYVLIDTPPFPVL
SDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALLINGAPTSQGGVYHYHP
RSSVRLDLEN
SITEWalker A147/149GKT
SITEWalker A'167/174LLIDADLR
SITEWalker B249/255VLIDTPP
SITE-246/-248YDY
SITEY Cluster315/317YHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFLLEKQKEAAISRASTITKNRILDTALVHSVPVSPKASKAVLIGAFLGLLLGLAVVFARFLLHKGFHSDEGILSRYPSI


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLFGKLPEYEAFQSVGDSAKIKPIVPSDPRSTYGEALRLLRGKLYLDSGAGNAGKVLMFSSAFQGDGKTTVVSQLAVALA
                                                           SSAFQGDGKTTVVSQLAVALA
                                                                  GKT           
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAKLEDCTRVMTRFDVPLTCLPSGQTPDSPVELIGKERFAELID
KDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAKLEDCTRVMTRFDVPLTCLPSGQTPDSPVELIGKERFAELID
      LLIDADLR                                                                  
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KARSEYDYVLIDTPPFPVLSDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALLINGAPTSQGGVYHYHPR
KARSEYDYVLIDTPPFPVLSDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALLINGAPTSQGGVYHYHPR
        VLIDTPP                                                           YHY   
       330       340  
....:....|....:....|..
SSVRLDLENRVRSFISQFQRKR
SSVRLDLEN             

© 1998-2019