BYKdb

Annotate results for A0A1C3D0P7

A0A1C3D0P7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3D0P7
DOMAINtad10/266DTIDLKELFFSLIAQWKVIALCIILSLICAIFYIRITPSVYSTDALVQVEDGKGAASAAL
LGELKDFSGGLGQKSPAEAEIEILNSRMVLGKVIHDLNLNITIKDSEDTPFNRLFSLENT
QLKYDTQGVSFSSKQHSFLVKQLDIPNFYLDKKLKLKFEDNAKFTLSDKDQIIFSGDLNK
LNQANDSKGTWKVNIVSNSPFQQDFFLTKLSATTAVELLKLNYTVAEKGKMTGVIGLNYR
GEDQQHITNVLNHILEI
DOMAINcd542/727SGPAPEVGKSFISTNLAAILAQSEKRVLIIDADLRRGYLHKYFNHDNQAGLAEYLNGQQN
LDTIIKTTEITGLSVITRGKSPTNPSELLSSAKFATLLEQLSPLYDHVIIDTPPILAVTD
GIIISQYTGVNLVIARYAKTQMKELEITINRFEQVGVKVNGIILNDIVRSAGGYGYNYSY
GYKAST
SITEWalker A549/551GKS
SITEWalker A'569/576LIIDADLR
SITEWalker B649/655VIIDTPP
SITE-579/-583YLHKY
SITE-620/-622GKS
SITEY Cluster715/723YGYNYSYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQNAKSDDDTIDLKELFFSLIAQWKVIALCIILSLICAIFYIRITPSVYSTDALVQVEDGKGAASAALLGELKDFSGGL
         DTIDLKELFFSLIAQWKVIALCIILSLICAIFYIRITPSVYSTDALVQVEDGKGAASAALLGELKDFSGGL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQKSPAEAEIEILNSRMVLGKVIHDLNLNITIKDSEDTPFNRLFSLENTQLKYDTQGVSFSSKQHSFLVKQLDIPNFYLD
GQKSPAEAEIEILNSRMVLGKVIHDLNLNITIKDSEDTPFNRLFSLENTQLKYDTQGVSFSSKQHSFLVKQLDIPNFYLD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKLKLKFEDNAKFTLSDKDQIIFSGDLNKLNQANDSKGTWKVNIVSNSPFQQDFFLTKLSATTAVELLKLNYTVAEKGKM
KKLKLKFEDNAKFTLSDKDQIIFSGDLNKLNQANDSKGTWKVNIVSNSPFQQDFFLTKLSATTAVELLKLNYTVAEKGKM

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGVIGLNYRGEDQQHITNVLNHILEIYHQQNIERKSLESKQTLGFLDQQLPELKQQLEKSELKFNDFREKYNTVDVTQES
TGVIGLNYRGEDQQHITNVLNHILEI                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELMLKQNIELEKMRIELKQKQAEFSAKYTADHPLMTEINAQINALDQKSKELSQAIKRLPETQRLYLQLYRDVKVNTELY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSLLNSYQQLKIANAGEIGNVRIIDTAIEPVKPIKPQKLIILVLSIFVGGFLGTLLALLRNMMRSGIKDSSQIENELDLP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYATVPRSPVQESRIKLLKKKKHIPILAVKNGDDIAIESLRSMRTAIHFALSAAKNNLIMISGPAPEVGKSFISTNLAAI
                                                             SGPAPEVGKSFISTNLAAI
                                                                    GKS         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAQSEKRVLIIDADLRRGYLHKYFNHDNQAGLAEYLNGQQNLDTIIKTTEITGLSVITRGKSPTNPSELLSSAKFATLLE
LAQSEKRVLIIDADLRRGYLHKYFNHDNQAGLAEYLNGQQNLDTIIKTTEITGLSVITRGKSPTNPSELLSSAKFATLLE
        LIIDADLR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLSPLYDHVIIDTPPILAVTDGIIISQYTGVNLVIARYAKTQMKELEITINRFEQVGVKVNGIILNDIVRSAGGYGYNYS
QLSPLYDHVIIDTPPILAVTDGIIISQYTGVNLVIARYAKTQMKELEITINRFEQVGVKVNGIILNDIVRSAGGYGYNYS
        VIIDTPP                                                           YGYNYS
       730
....:....|
YGYKASTEQD
YGYKAST   
YGY       

© 1998-2019