BYKdb

Annotate results for A0A1C3F3Q4

A0A1C3F3Q4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C3F3Q4
DOMAINcd21/209TSSGPREGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQHKLFGLDNGEGLSVFLVQDQD
YCKYIRETAVPGVMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMLLIDTPPVIAVTD
AAILAQEVDGVILVLASGEVNKGYAQKAKEQLDKLGVKILGAVLNKVDMNTKEYYYYYYY
NASDDTKKK
SITEWalker A28/30GKS
SITEWalker A'48/55LIIDADLR
SITEWalker B128/134LLIDTPP
SITE-81/-84YCKY
SITE-44/-46GKS
SITEY Cluster194/200YYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLRTNIQFTSVDLETQKIMITSSGPREGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQHKLFGLDNGEGLSVFLVQDQD
                    TSSGPREGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQHKLFGLDNGEGLSVFLVQDQD
                           GKS                 LIIDADLR                         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YCKYIRETAVPGVMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMLLIDTPPVIAVTDAAILAQEVDGVILVLASGEV
YCKYIRETAVPGVMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMLLIDTPPVIAVTDAAILAQEVDGVILVLASGEV
                                               LLIDTPP                          
       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
NKGYAQKAKEQLDKLGVKILGAVLNKVDMNTKEYYYYYYYNASDDTKKKHNRRSS
NKGYAQKAKEQLDKLGVKILGAVLNKVDMNTKEYYYYYYYNASDDTKKK      
                                 YYYYYYY               
© 1998-2019