BYKdb

Annotate results for A0A1C3N102

A0A1C3N102 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3N102
DOMAINtad1/134MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQG
GLFLQQRVKSYADLLTSDRLAQTVVAENNVGLTADEVQRRVSTSTEAGTVLLEASVTDTD
QARALKVTETLAAK
DOMAINcd265/453TSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGIDAGVGLTDVLVGDVQ
VGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTD
GVVVAVQADGALLVSQQGRTSRAQVAAAARALHAVSVRLLGCVLNMAKMPKAEAYQYEAY
RVVAAAESS
SITEWalker A272/274GKT
SITEWalker A'292/299LLVDADLR
SITEWalker B372/378VIIDTAP
SITEY Cluster439/444YQYEAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLTSDRL
MDLLRQLRHVRRHWWVVLVTVMVALGVSAFLTVRAQPRYVASVTFFVTTPNQGVTDAYQGGLFLQQRVKSYADLLTSDRL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQTVVAENNVGLTADEVQRRVSTSTEAGTVLLEASVTDTDQARALKVTETLAAKFVELVQKIETPPDGKAPLKIEVVSGP
AQTVVAENNVGLTADEVQRRVSTSTEAGTVLLEASVTDTDQARALKVTETLAAK                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVSSEPVSPQPVRNLVLGGLLGLVLGIGLAILRGVADIRLRDAAGLQRATGSPLLGEIPYESGARSAPLIVGDAATSSRA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGIDAGVGLTDVLV
                        TSALQGEGKTTLSCNLAIALAEAGWRVLLVDADLRRPKVDDYLGIDAGVGLTDVLV
                               GKT                 LLVDADLR                     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVSQ
GDVQVGDVVQRWGDKSLLVLPSGSAPPNPSELLGSKAMADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLVSQ
                                                   VIIDTAP                      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGRTSRAQVAAAARALHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVAAAESSVAASDGAATPRHAEGGRLNGVSDRTQE
QGRTSRAQVAAAARALHAVSVRLLGCVLNMAKMPKAEAYQYEAYRVVAAAESS                           
                                      YQYEAY                                    
      
....:.
LTRLPR


© 1998-2019