BYKdb

Annotate results for A0A1C3SIT1

A0A1C3SIT1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C3SIT1
DOMAINcd51/227TSGLPGEGKSFTAANLAVVFSQQEKKVLLIDADLRKPSIHKIFQLDNHSGVTNVLMKKTH
LENVVQQSQAESLHVLTSGPIPPNPAELLSSQAMEDLLAEAYKQYDLVLLDSPPLLPVAD
AQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
SITE-188/-190GKT
SITEWalker A'78/85LLIDADLR
SITEWalker B158/164VLLDSPP
SITE-152/-155YKQY
SITEY Cluster225/227YNY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIRKKRSRKYESALVALHQPNTPIVEQYRTIRTNIEFSSFEKPFRSLLITSGLPGEGKSFTAANLAVVFSQQEKKVLLI
                                                  TSGLPGEGKSFTAANLAVVFSQQEKKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQAESLHVLTSGPIPPNPAELLSSQAMEDLLAEAYKQYDLVLL
DADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQAESLHVLTSGPIPPNPAELLSSQAMEDLLAEAYKQYDLVLL
DADLR                                                                        VLL
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
DSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
DSPP                                                            YNY
© 1998-2019