BYKdb

Annotate results for A0A1C3SZH1

A0A1C3SZH1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3SZH1
DOMAINtad15/259DSLDLGKVIGEIIDNLKLIISFMLLFTTLAIIYVLFSTPVYKSDALIQIEAKQGNAILSS
LSQVLPDGQLQSAPEISLIQSRMVLGKTVDDLNLQAVVTQDYIPFIGKGWARLTGEEPGS
IAISKIWMPVKTFDVESDDDTLSKIKITIIDSKKYTVSGEGISEQVGQLGQPIEQKNLNL
VIDRIDAKPGTSFSVNYLTKLKAISNLQEILSISEQGKSTGILNLSITGTDPLKISQILN
DVAHN
DOMAINcd539/728SGASPNAGKTFISSNLVAVIAQTGKKVLLIDGDMRKGYMHHLFGLSKDNGLSDILSGKER
VEDVIQSLPLSGFDFIPRGKIPPNPAELLMHERFDRLIEWAESKYDFVLIDTPPILAVTD
AAIIGRNAGTTMLVARFEINTPKEIEVSIKRFEQSGISVKGCILNAVVKKTSGYYSYGYN
HYGYSYEDKG
SITEWalker A546/548GKT
SITEWalker A'566/573LLIDGDMR
SITEWalker B646/652VLIDTPP
SITEY Cluster712/724YYSYGYNHYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLPKLSNEPKSSDSDSLDLGKVIGEIIDNLKLIISFMLLFTTLAIIYVLFSTPVYKSDALIQIEAKQGNAILSSLSQVLP
              DSLDLGKVIGEIIDNLKLIISFMLLFTTLAIIYVLFSTPVYKSDALIQIEAKQGNAILSSLSQVLP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGQLQSAPEISLIQSRMVLGKTVDDLNLQAVVTQDYIPFIGKGWARLTGEEPGSIAISKIWMPVKTFDVESDDDTLSKIK
DGQLQSAPEISLIQSRMVLGKTVDDLNLQAVVTQDYIPFIGKGWARLTGEEPGSIAISKIWMPVKTFDVESDDDTLSKIK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITIIDSKKYTVSGEGISEQVGQLGQPIEQKNLNLVIDRIDAKPGTSFSVNYLTKLKAISNLQEILSISEQGKSTGILNLS
ITIIDSKKYTVSGEGISEQVGQLGQPIEQKNLNLVIDRIDAKPGTSFSVNYLTKLKAISNLQEILSISEQGKSTGILNLS

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITGTDPLKISQILNDVAHNYVSQNIERQAAQDAKSLDFLNQQLPKVRDDLYQAEDKLNSYRREKDSVDLSLEAKSILDQI
ITGTDPLKISQILNDVAHN                                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNVDNQLNELTFREAEISQLYTKEHPTYKALNEKRATLEQEKTKLNKRVATMPATQQEVLRLSRDVESGRAVYMQLLNRQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELNIAKSSAIGNVRIIDDAQTEDDPVKPKKALIVILGFLFGAGLSISLITLRTLLRRGIESPEQLEELGINVYASIPIS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DWLQKKASQITYKDKNKKEHAAYLAIENPADIAIEAIRSLRTSLHFAMMEAKNNVIMISGASPNAGKTFISSNLVAVIAQ
                                                          SGASPNAGKTFISSNLVAVIAQ
                                                                 GKT            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGKKVLLIDGDMRKGYMHHLFGLSKDNGLSDILSGKERVEDVIQSLPLSGFDFIPRGKIPPNPAELLMHERFDRLIEWAE
TGKKVLLIDGDMRKGYMHHLFGLSKDNGLSDILSGKERVEDVIQSLPLSGFDFIPRGKIPPNPAELLMHERFDRLIEWAE
     LLIDGDMR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKYDFVLIDTPPILAVTDAAIIGRNAGTTMLVARFEINTPKEIEVSIKRFEQSGISVKGCILNAVVKKTSGYYSYGYNHY
SKYDFVLIDTPPILAVTDAAIIGRNAGTTMLVARFEINTPKEIEVSIKRFEQSGISVKGCILNAVVKKTSGYYSYGYNHY
     VLIDTPP                                                           YYSYGYNHY
         
....:....
GYSYEDKGK
GYSYEDKG 
GYSY     

© 1998-2019