BYKdb

Annotate results for A0A1C3T070

A0A1C3T070 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3T070
DOMAINtad14/252EEIELNKLIGEFIDHRKLIFSIISIFILLSLLYVIFSTPIYQSDALVQIEEKQGNAILSN
LSQMLPDSQPSSAPEMALLQSRMILGKTVDDLNLQAQITQNYIPIIGRGLAKLSGDKIGD
IQISHFFMPKEWGAEDNNEFTLTVIDNNNYKITNKLVDLQGRVGELLDKDGLLLNISNID
AEPGTTFTIRHLTKLQAIGQLQKSFTVADMGKDSGIMQLTYEDANPELAARVLQSISNN
DOMAINcd528/717SGATPGVGKTFVSSNLAIIIAVTGKKVLFIDADMRRGYVHKLFSQRNDKGLSTYLSGKTA
LSEVVKHQVFENVDFITRGEAPPNPAELLMHNRFEKMIEWANENYDLIIIDTPPILAVTD
PVIIGKYAGTSLLISRFEQNTIREVEVSIKRFEQNGITIKGCILNGMHKKASSYYGYGYN
HYGYDYTGKE
SITE-584/-586GKT
SITEWalker A'555/562LFIDADMR
SITEWalker B635/641IIIDTPP
SITEY Cluster701/713YYGYGYNHYGYDY
SITEWalker A535/537GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSATINKSADKDSEEIELNKLIGEFIDHRKLIFSIISIFILLSLLYVIFSTPIYQSDALVQIEEKQGNAILSNLSQMLPD
             EEIELNKLIGEFIDHRKLIFSIISIFILLSLLYVIFSTPIYQSDALVQIEEKQGNAILSNLSQMLPD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQPSSAPEMALLQSRMILGKTVDDLNLQAQITQNYIPIIGRGLAKLSGDKIGDIQISHFFMPKEWGAEDNNEFTLTVIDN
SQPSSAPEMALLQSRMILGKTVDDLNLQAQITQNYIPIIGRGLAKLSGDKIGDIQISHFFMPKEWGAEDNNEFTLTVIDN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNYKITNKLVDLQGRVGELLDKDGLLLNISNIDAEPGTTFTIRHLTKLQAIGQLQKSFTVADMGKDSGIMQLTYEDANPE
NNYKITNKLVDLQGRVGELLDKDGLLLNISNIDAEPGTTFTIRHLTKLQAIGQLQKSFTVADMGKDSGIMQLTYEDANPE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAARVLQSISNNYLAQNVARQAAQDEKSLEFLNSQLPKVRTDLDHSEDLLNDYRRKKDSVDLSMEAKSVLDQIVNVDNQL
LAARVLQSISNN                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTFREAEISQLYTKEHPTYRALIEKRKTLRNEREKLDNKVSAMPETQQEVLRLSRDVESGQAVYMQLLNRQQELNIAK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSVIGNVRIIDNAVTQPKPIKPNAILAVFIGIALGIVFSLAYVLVKVFLRRGIESPDQLEELGVNVYASIPVSETLAKIS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRKGKTSIGQGPLAIENPVDLAIEAIRGLRTSLHFAMMESRNNVLMISGATPGVGKTFVSSNLAIIIAVTGKKVLFIDAD
                                               SGATPGVGKTFVSSNLAIIIAVTGKKVLFIDAD
                                                      GKT                 LFIDAD
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRGYVHKLFSQRNDKGLSTYLSGKTALSEVVKHQVFENVDFITRGEAPPNPAELLMHNRFEKMIEWANENYDLIIIDTP
MRRGYVHKLFSQRNDKGLSTYLSGKTALSEVVKHQVFENVDFITRGEAPPNPAELLMHNRFEKMIEWANENYDLIIIDTP
MR                                                                        IIIDTP
       650       660       670       680       690       700       710       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
PILAVTDPVIIGKYAGTSLLISRFEQNTIREVEVSIKRFEQNGITIKGCILNGMHKKASSYYGYGYNHYGYDYTGKE
PILAVTDPVIIGKYAGTSLLISRFEQNTIREVEVSIKRFEQNGITIKGCILNGMHKKASSYYGYGYNHYGYDYTGKE
P                                                           YYGYGYNHYGYDY    

© 1998-2019