BYKdb

Annotate results for A0A1C3T096

A0A1C3T096 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3T096
DOMAINtad2/241RDLILQLSKSSIYSTKPLIISITSVFTLFAILYALLATPIYETDALIQIEQKQGNAILSS
LSQVLPDGQPQSAPETALLQSRMILGKTIDDLNLQIQIKQKYFPVIGRGLARLMGEKPGN
IDITRLYLPGSDDISNNTPSIILTVKDKENYSINSDGIQLNGVVGTLLNEKGISLLVNEI
DAKPGDQFVITQLPRLKAISDLLKSFSVADLGKDTGMLTLTLTGDNPKRISHILDSISQN
DOMAINcd519/708SGASQSAGKTFISNNLAATIAITGKKVLFIDADLRKGYAHKMFGHKNDKGLSEFLSGQAA
AEMVIDKVEGGEFDYIGRGQIPPNPAELLMHPRFEQLLNWASQNYDLIIIDTPPILAVTD
AAIIGRYAGTCLLVARFEKNTVKEIDVSMKRFEQSGVVVKGCILNGVVKKASSYYGYGYN
HYGYSYSDKK
SITEWalker A526/528GKT
SITEWalker A'546/553LFIDADLR
SITEWalker B626/632IIIDTPP
SITEY Cluster692/704YYGYGYNHYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRDLILQLSKSSIYSTKPLIISITSVFTLFAILYALLATPIYETDALIQIEQKQGNAILSSLSQVLPDGQPQSAPETALL
 RDLILQLSKSSIYSTKPLIISITSVFTLFAILYALLATPIYETDALIQIEQKQGNAILSSLSQVLPDGQPQSAPETALL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSRMILGKTIDDLNLQIQIKQKYFPVIGRGLARLMGEKPGNIDITRLYLPGSDDISNNTPSIILTVKDKENYSINSDGIQ
QSRMILGKTIDDLNLQIQIKQKYFPVIGRGLARLMGEKPGNIDITRLYLPGSDDISNNTPSIILTVKDKENYSINSDGIQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNGVVGTLLNEKGISLLVNEIDAKPGDQFVITQLPRLKAISDLLKSFSVADLGKDTGMLTLTLTGDNPKRISHILDSISQ
LNGVVGTLLNEKGISLLVNEIDAKPGDQFVITQLPRLKAISDLLKSFSVADLGKDTGMLTLTLTGDNPKRISHILDSISQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYLAQNIARQAAQDAKSLEFLNQQLPKVRAELDSAEDKLNAYRKQKDSVDLNMEAKSVLDQIVNVDNQLNELTFREAEVS
N                                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLYTKEHPTYKALMEKRQTLQEEKSKLNKRVSSMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAKSSAIGNVRIID


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAVTDPNPVRPKKTIIIVIGVVLGLIVSVVLVLFQVFLRRGIESPEQLEEIGINVYASIPISEWLAKNARQSGKVRKNQS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTLLAVGNPADLAVEAIRGLRTSLHFAMMEAKNNVLMISGASQSAGKTFISNNLAATIAITGKKVLFIDADLRKGYAHKM
                                      SGASQSAGKTFISNNLAATIAITGKKVLFIDADLRKGYAHKM
                                             GKT                 LFIDADLR       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGHKNDKGLSEFLSGQAAAEMVIDKVEGGEFDYIGRGQIPPNPAELLMHPRFEQLLNWASQNYDLIIIDTPPILAVTDAA
FGHKNDKGLSEFLSGQAAAEMVIDKVEGGEFDYIGRGQIPPNPAELLMHPRFEQLLNWASQNYDLIIIDTPPILAVTDAA
                                                                 IIIDTPP        
       650       660       670       680       690       700       710
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIGRYAGTCLLVARFEKNTVKEIDVSMKRFEQSGVVVKGCILNGVVKKASSYYGYGYNHYGYSYSDKKID
IIGRYAGTCLLVARFEKNTVKEIDVSMKRFEQSGVVVKGCILNGVVKKASSYYGYGYNHYGYSYSDKK  
                                                   YYGYGYNHYGYSY      

© 1998-2019