BYKdb

Annotate results for A0A1C3T132

A0A1C3T132 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3T132
DOMAINtad15/252DDIDLGKIVGELIDHRKLIIAISTAFTVIAVLYALLATPIYQSTALIQVEQKQGNAILDS
LSQMLPDSQPQSAPEIALIQSRMILGKTVDDLNLQAEIEPKYFPIFGRGLARLLGKEPGT
ISVPRFYLDTGSNDVPSEVTLTILGENNFEIEGEGFSLKGKKGVLLEDKGVSILVDSIDA
QPGSQFKITYISRLKAISNLLESLNVADQGKDTGMLNLTFTGDNPTLISQVLSSITQN
DOMAINcd529/718SGASPNAGKTFVSTNLAATIAMTGKKVLFIDSDLRKGYVHKMLGSENVKGLSDILSGQAK
VESIIERVSGGEFDYIGRGQTPPNPAELLMHPRFKELLSWASQNYELVIVDTPPILAVTD
AAIIGQYAGTTLLVARFEANTAKEIAVSIKRFEQTGVVIKGCILNGVMKKASSYYSYGYS
QYGYSYTDNK
SITEWalker A536/538GKT
SITEWalker A'556/563LFIDSDLR
SITEWalker B636/642VIVDTPP
SITEY Cluster702/714YYSYGYSQYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASVTNNKQTPTESDDIDLGKIVGELIDHRKLIIAISTAFTVIAVLYALLATPIYQSTALIQVEQKQGNAILDSLSQMLP
              DDIDLGKIVGELIDHRKLIIAISTAFTVIAVLYALLATPIYQSTALIQVEQKQGNAILDSLSQMLP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSQPQSAPEIALIQSRMILGKTVDDLNLQAEIEPKYFPIFGRGLARLLGKEPGTISVPRFYLDTGSNDVPSEVTLTILGE
DSQPQSAPEIALIQSRMILGKTVDDLNLQAEIEPKYFPIFGRGLARLLGKEPGTISVPRFYLDTGSNDVPSEVTLTILGE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNFEIEGEGFSLKGKKGVLLEDKGVSILVDSIDAQPGSQFKITYISRLKAISNLLESLNVADQGKDTGMLNLTFTGDNPT
NNFEIEGEGFSLKGKKGVLLEDKGVSILVDSIDAQPGSQFKITYISRLKAISNLLESLNVADQGKDTGMLNLTFTGDNPT

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LISQVLSSITQNYLAQNVERQAAQDAKSLEFLNEQLPKVRTDLDAAEDKLNNYRKQKDSVDLTMEAKSVLDQIVNVDNQL
LISQVLSSITQN                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTFREAEISQLYTKEHPTYKALMEKRQTLQTERNKLNKKVSSMPSTQQEVLRLSRDVESGRAVYLQLLSRQQELNIAK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSAIGNVRIIDNAITEPKPVKPKKILVIALGIIIGLFFSVGFVFVRVFLRRGIESPEQLEEMGINVYASIPVSEWLTKNT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKNKRQKNESDTLLAVENPADLAVEAIRSLRTSLHFAMMESKNNILMISGASPNAGKTFVSTNLAATIAMTGKKVLFIDS
                                                SGASPNAGKTFVSTNLAATIAMTGKKVLFIDS
                                                       GKT                 LFIDS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKGYVHKMLGSENVKGLSDILSGQAKVESIIERVSGGEFDYIGRGQTPPNPAELLMHPRFKELLSWASQNYELVIVDT
DLRKGYVHKMLGSENVKGLSDILSGQAKVESIIERVSGGEFDYIGRGQTPPNPAELLMHPRFKELLSWASQNYELVIVDT
DLR                                                                        VIVDT
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPILAVTDAAIIGQYAGTTLLVARFEANTAKEIAVSIKRFEQTGVVIKGCILNGVMKKASSYYSYGYSQYGYSYTDNKSK
PPILAVTDAAIIGQYAGTTLLVARFEANTAKEIAVSIKRFEQTGVVIKGCILNGVMKKASSYYSYGYSQYGYSYTDNK  
PP                                                           YYSYGYSQYGYSY      

© 1998-2019