BYKdb

Annotate results for A0A1C3U7Y9

A0A1C3U7Y9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3U7Y9
DOMAINtad34/217SFIDLDRLMAVVIRRIRTIIFAVAAFVILAVAYLLTATSSYTSMTQILLDETMTKYAEDQ
PPAASSQQADMEIASAVEILKSNEMALRVVDTAGLSDNNTLLNPPVSPAALLKSGVSLIV
SVFTPGRPPMTPEEQREAQRQKVAAVLQDNLKVERVTRSSVVAVSFSSTDKRLAAKVTSA
YADA
DOMAINcd593/784VSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQAGLIEAVLGEVP
WTNAVKVDPRTKLAILPVAVRDQLLHTSELLSSQGMQHLMENARKMFDYIIVDLAPLGPV
IDAKAFAPQVDAFLLVTEWGATPTNLVRDVLEQEPQINSRILGVILNKTDMSELPRYSDF
GGTERYRQKYVS
SITEWalker A600/602GKS
SITEWalker A'620/627LLIDADLR
SITEWalker B702/708IIVDLAP
SITEY Cluster778/786YRQKYVSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIVHSGFSDKVVAMHQKNFTFHSALPQAESQDSFIDLDRLMAVVIRRIRTIIFAVAAFVILAVAYLLTATSSYTSMTQI
                                 SFIDLDRLMAVVIRRIRTIIFAVAAFVILAVAYLLTATSSYTSMTQI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDETMTKYAEDQPPAASSQQADMEIASAVEILKSNEMALRVVDTAGLSDNNTLLNPPVSPAALLKSGVSLIVSVFTPGR
LLDETMTKYAEDQPPAASSQQADMEIASAVEILKSNEMALRVVDTAGLSDNNTLLNPPVSPAALLKSGVSLIVSVFTPGR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPMTPEEQREAQRQKVAAVLQDNLKVERVTRSSVVAVSFSSTDKRLAAKVTSAYADAYLTDQLNANFDATERASVWLQER
PPMTPEEQREAQRQKVAAVLQDNLKVERVTRSSVVAVSFSSTDKRLAAKVTSAYADA                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNDLRQRAQEASLEVEKYKADNGLTSTGGELMSEQQISDLNKQLIIAQADTASAAARYNQYKSIIDQGPDNAVKNATISS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSTDNSVLQDLKTRYLAVEKREQDVTQNFGADHPQAVALKAERQDITRQIYQVLQQLTASYKNELDVAQSRAESLRESID


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVVGKNSEANKSLVHLNELNQKASALKTLYESYLGRFEQATQQRSFPIAKARVISVAGVPTAPSSPKKTLVMALSVILGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVGCGVAAFQEFRDRFFRVEADVRAALGLKFLGYLPLLGQQSKNNKNKKKSRKADAGAEPITAEEGENGVAFERMMRISV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAPRSIFAETLRNAKLASDVMLQGRADRVIGVVSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQ
                                VSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQ
                                       GKS                 LLIDADLR             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLIEAVLGEVPWTNAVKVDPRTKLAILPVAVRDQLLHTSELLSSQGMQHLMENARKMFDYIIVDLAPLGPVIDAKAFAP
AGLIEAVLGEVPWTNAVKVDPRTKLAILPVAVRDQLLHTSELLSSQGMQHLMENARKMFDYIIVDLAPLGPVIDAKAFAP
                                                             IIVDLAP            
       730       740       750       760       770       780       790       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
QVDAFLLVTEWGATPTNLVRDVLEQEPQINSRILGVILNKTDMSELPRYSDFGGTERYRQKYVSYYTEAQPRAQVDA
QVDAFLLVTEWGATPTNLVRDVLEQEPQINSRILGVILNKTDMSELPRYSDFGGTERYRQKYVS             
                                                         YRQKYVSYY           

© 1998-2019