BYKdb

Annotate results for A0A1C3UQX1

A0A1C3UQX1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3UQX1
DOMAINtad34/217SFIDLDRLMAIVTRRIRTILLTVAACVILAVAYLLTATSSYTSMTQILLDESMTKYAEDQ
PPAASGQQADMEIASAVEILKSNEMALRVADTGGLADNNTLLNPPLSPAALLKSGVGLIV
SIFTPGRPPMTPEEQREAQRQKVAAVLQDNLKVERVTRSSVVAVSYSSTDKQLAAKVTRA
YADA
DOMAINcd590/781VSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKSPPQAGLIEAVLGEVP
WTNAVKVDPRTKLAILPVAVRDHLLHTSELLSSQGMQHLMENARKLFDYIVVDLAPLGPV
IDAKAFAPQVDAFLLVAEWGATPTNLVRDILEQEPQINSRILGVILNKTDMSELPRYSDF
GGTERYRQKYVS
SITEWalker A597/599GKS
SITEWalker A'617/624LLIDADLR
SITEWalker B699/705IVVDLAP
SITEY Cluster775/783YRQKYVSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIVHSGFSDKVVAMHQKNFTFHSALPQGESQDSFIDLDRLMAIVTRRIRTILLTVAACVILAVAYLLTATSSYTSMTQI
                                 SFIDLDRLMAIVTRRIRTILLTVAACVILAVAYLLTATSSYTSMTQI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDESMTKYAEDQPPAASGQQADMEIASAVEILKSNEMALRVADTGGLADNNTLLNPPLSPAALLKSGVGLIVSIFTPGR
LLDESMTKYAEDQPPAASGQQADMEIASAVEILKSNEMALRVADTGGLADNNTLLNPPLSPAALLKSGVGLIVSIFTPGR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPMTPEEQREAQRQKVAAVLQDNLKVERVTRSSVVAVSYSSTDKQLAAKVTRAYADAYLTDQLNANFDATERASVWLQER
PPMTPEEQREAQRQKVAAVLQDNLKVERVTRSSVVAVSYSSTDKQLAAKVTRAYADA                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNDLRQRSQEASLEVEKYKADNGLTSTGGELMSEQQISDLNKQLIIAQADSASASARYNQYKSIIDQGPDNAVKNATISS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQTDNSVLQDLKTRYLAVQKREQDVTQNFGANHPQAVALRAERQDITRQIYQELQQLTASYKNEYDVAQSRASSLRESIE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVVGKNSEANKSLVHLNELNQKATALKSLYESYLGRFEQATQQRSFPIAKARVISVAGVPTAPSSPKRTLIMALSVILGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAGCGLAALQEFRDRFFRVEADVRMALGLKFLGYLPLLGQQSKSKKKPRKPNAGPVPATAEEPENGVAFERIMRISVEAP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSIFAETLRNAKLASDIMLQGRADRVIGVVSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKSPPQAGL
                             VSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKSPPQAGL
                                    GKS                 LLIDADLR                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEAVLGEVPWTNAVKVDPRTKLAILPVAVRDHLLHTSELLSSQGMQHLMENARKLFDYIVVDLAPLGPVIDAKAFAPQVD
IEAVLGEVPWTNAVKVDPRTKLAILPVAVRDHLLHTSELLSSQGMQHLMENARKLFDYIVVDLAPLGPVIDAKAFAPQVD
                                                          IVVDLAP               
       730       740       750       760       770       780       790    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
AFLLVAEWGATPTNLVRDILEQEPQINSRILGVILNKTDMSELPRYSDFGGTERYRQKYVSYYTEAQPRAQVDA
AFLLVAEWGATPTNLVRDILEQEPQINSRILGVILNKTDMSELPRYSDFGGTERYRQKYVS             
                                                      YRQKYVSYY           

© 1998-2019