BYKdb

Annotate results for A0A1C3X203

A0A1C3X203 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C3X203
DOMAINtad30/209ITDVINFGIGLLRRQYLVILVTAVLATAASLLYLRVASPTYTAQVQILLANPRPQFVQQQ
SLLAEPAFDLSQIETQLQLLRSKANAVAVINKLKLAEDPDFSASGLSLQALWQRIWPWPS
TRSKKDAPPETNGEPSDTLVDAFLSRLSAGRVGYSRVIEISYSSSNAARAAEIVNAIADT
DOMAINcd581/771TSALPNEGKTTIAASLAQLIGHTGKRAIIVDCDLRNPSLTGIFAPKAACGIIEVANGSRS
LAEAVWRDPTTNLAFLPAVRRGPLLHTSEILCADSISKLFDRLRAEYDYIIVDLPPLTPL
VDVRATSSLIDCYILVVEWGRTKIDVVQHALHTAPNVHESLIGAVLSKTDTKAMARYDGH
RSYYYHDSHYI
SITEWalker A588/590GKT
SITEWalker A'608/615IIVDCDLR
SITEWalker B690/696IIVDLPP
SITE-687/-689YDY
SITEY Cluster757/773YDGHRSYYYHDSHYIRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQNNLQHADRMRLPVNGPAQPAQADGGGITDVINFGIGLLRRQYLVILVTAVLATAASLLYLRVASPTYTAQVQILLAN
                             ITDVINFGIGLLRRQYLVILVTAVLATAASLLYLRVASPTYTAQVQILLAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRPQFVQQQSLLAEPAFDLSQIETQLQLLRSKANAVAVINKLKLAEDPDFSASGLSLQALWQRIWPWPSTRSKKDAPPET
PRPQFVQQQSLLAEPAFDLSQIETQLQLLRSKANAVAVINKLKLAEDPDFSASGLSLQALWQRIWPWPSTRSKKDAPPET

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NGEPSDTLVDAFLSRLSAGRVGYSRVIEISYSSSNAARAAEIVNAIADTYVADQLNAKFDANRKATSWLQERLRDLGDQA
NGEPSDTLVDAFLSRLSAGRVGYSRVIEISYSSSNAARAAEIVNAIADT                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAQRAVDVYKAQNNIVSLGGKPIDEQQITEINNRLAAARAQTSEATAKLARYETLLAVDPKKPSSIDNLDAIGTDALNS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIITGLRQQYLELTRREAELAARVGRDHLAVVNIRNRAREFRVSIFDEVKRLAEVSRSEFELAKQRQEEIEKQLSKAVSQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRSVNSAELTIKDLESKAKGLHSLYETFLQRYMGSTQQETFPTSDTRVLFPASPPASKSKPKARLILAFGILGGLALGIG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LALLRDLMDRVFRTSSQVETVLELPCLSLVPLLPARKSPKPPIRLQKTDDDVQRRIASSPTAIHQTVVGMPLSRYTEAIR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIKLAIDHNPAKISSQVVGITSALPNEGKTTIAASLAQLIGHTGKRAIIVDCDLRNPSLTGIFAPKAACGIIEVANGSRS
                    TSALPNEGKTTIAASLAQLIGHTGKRAIIVDCDLRNPSLTGIFAPKAACGIIEVANGSRS
                           GKT                 IIVDCDLR                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEAVWRDPTTNLAFLPAVRRGPLLHTSEILCADSISKLFDRLRAEYDYIIVDLPPLTPLVDVRATSSLIDCYILVVEWG
LAEAVWRDPTTNLAFLPAVRRGPLLHTSEILCADSISKLFDRLRAEYDYIIVDLPPLTPLVDVRATSSLIDCYILVVEWG
                                                 IIVDLPP                        
       730       740       750       760       770        
....:....|....:....|....:....|....:....|....:....|....:...
RTKIDVVQHALHTAPNVHESLIGAVLSKTDTKAMARYDGHRSYYYHDSHYIRYGLSGS
RTKIDVVQHALHTAPNVHESLIGAVLSKTDTKAMARYDGHRSYYYHDSHYI       
                                    YDGHRSYYYHDSHYIRY     

© 1998-2019