BYKdb

Annotate results for A0A1C4FI90

A0A1C4FI90 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C4FI90
DOMAINtad15/151RSFSMDHLRFLVRRNWWIVALSGAVIGCLGLGYCLLQTPLYVSSAKLYVTSGTEADAQSA
YQGSLASQQRVASYAELVDSDVIIREALDDSGLQMSIDDARESLSATSNPDTVLLRISAE
NSDPALATQLANGVAEA
DOMAINcd283/471TSPGPGEGKTTTSMNLAAALAEDGNRVVLVDADLRRPSIARRLGLTGAVGLTSFLRGDGV
ISDFVQAGPVHGLDVLVAGALPPNPAELLGSHRAKDGIEALQSSYDFVIVDTPPVLPVAD
AAILSQFTDGALVVVRAGRTRSQDLTTAFSSLRTAQASILGIVLNDVSAHDSRYVYYSYE
QQMAGRERA
SITEWalker A290/292GKT
SITEWalker A'310/317VLVDADLR
SITEWalker B390/396VIVDTPP
SITEY Cluster456/461YVYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSSNIAPDGAPTARSFSMDHLRFLVRRNWWIVALSGAVIGCLGLGYCLLQTPLYVSSAKLYVTSGTEADAQSAYQGSLA
              RSFSMDHLRFLVRRNWWIVALSGAVIGCLGLGYCLLQTPLYVSSAKLYVTSGTEADAQSAYQGSLA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQQRVASYAELVDSDVIIREALDDSGLQMSIDDARESLSATSNPDTVLLRISAENSDPALATQLANGVAEAMTSYVTTLE
SQQRVASYAELVDSDVIIREALDDSGLQMSIDDARESLSATSNPDTVLLRISAENSDPALATQLANGVAEA         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPNEASQPLAKLTVVSPAVQPDEPFSPRTARNTVLAVLVGLVLGLLIAVLRERFDTRLRNGDEVQRSVSSAVLAEVPSEN


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLDGNPVIDFSVGSSRAAEGYRRLRTNLAFVRVDEPPRCILVTSPGPGEGKTTTSMNLAAALAEDGNRVVLVDADLRRPS
                                          TSPGPGEGKTTTSMNLAAALAEDGNRVVLVDADLRRPS
                                                 GKT                 VLVDADLR   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IARRLGLTGAVGLTSFLRGDGVISDFVQAGPVHGLDVLVAGALPPNPAELLGSHRAKDGIEALQSSYDFVIVDTPPVLPV
IARRLGLTGAVGLTSFLRGDGVISDFVQAGPVHGLDVLVAGALPPNPAELLGSHRAKDGIEALQSSYDFVIVDTPPVLPV
                                                                     VIVDTPP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADAAILSQFTDGALVVVRAGRTRSQDLTTAFSSLRTAQASILGIVLNDVSAHDSRYVYYSYEQQMAGRERATGKHVAPAR
ADAAILSQFTDGALVVVRAGRTRSQDLTTAFSSLRTAQASILGIVLNDVSAHDSRYVYYSYEQQMAGRERA         
                                                       YVYYSY                   
       490       500
....:....|....:....|
DQASVEGDVPRVGTATGSTT


© 1998-2019