BYKdb

Annotate results for A0A1C4UD01

A0A1C4UD01 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C4UD01
DOMAINtad1/134MDVLGYLRLVRRHWWIVLVTVMIAVGAAALVTIRTAPRYEASVTFFVTTPSQGVTDAYQG
SLFLQQRVKSYGDLLTSDRLAQSVVAEAPLGLTADQVQHRITTSTEAGTVLLKATVTDTD
QTRALKTTETLSAK
DOMAINcd266/454TSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVLVGDVQ
VGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTD
GVVVAVQADGALLVTQQGRTSRSQVAAAAHALHSVSVRLLGCVLNMAKVAKADAYQYEAY
KVVVPAAGP
SITEWalker A273/275GKT
SITEWalker A'293/300LLIDADLR
SITEWalker B373/379VVIDTAP
SITEY Cluster440/445YQYEAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDVLGYLRLVRRHWWIVLVTVMIAVGAAALVTIRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL
MDVLGYLRLVRRHWWIVLVTVMIAVGAAALVTIRTAPRYEASVTFFVTTPSQGVTDAYQGSLFLQQRVKSYGDLLTSDRL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQSVVAEAPLGLTADQVQHRITTSTEAGTVLLKATVTDTDQTRALKTTETLSAKFIELVQKVETPPDGKAPPIKLEVVSG
AQSVVAEAPLGLTADQVQHRITTSTEAGTVLLKATVTDTDQTRALKTTETLSAK                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRVTSSPVSPQPVRNLVIGGLLGLLLGAGLAVLRGLADVRMRDAAALQRVTGSPLLGEIPFESGAKAAPLIVGEAANSPR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAVRKLRTNLRFVDVHEPARVIAVTSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
                         TSALQGEGKTTMACNTAIALAEAGWRVLLIDADLRRPKVADYLGLDGGVGLTDVL
                                GKT                 LLIDADLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
VGDVQVGDVVQRWGDKSLLVLPSGATPPNPSELLGSKAMADLLVALRESADIVVIDTAPLLAVTDGVVVAVQADGALLVT
                                                    VVIDTAP                     
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQGRTSRSQVAAAAHALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPAAGPSVPTDRAGVARRGEKAPVGDHTQELT
QQGRTSRSQVAAAAHALHSVSVRLLGCVLNMAKVAKADAYQYEAYKVVVPAAGP                          
                                       YQYEAY                                   
    
....
RLSR


© 1998-2019