BYKdb

Annotate results for A0A1C5KH19

A0A1C5KH19 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5KH19
DOMAINcd40/228TSSIPNEGKSILVYRTSCSMAETGKKVLMIDTDIRKSVLVNRLGIDKPGKGLSEYLSGQC
SLDECLYETNVENLHMILTGPVAPNPSELLGSDRFKKLIAKARETYDYVLIDCPPLGSVI
DAAIVASAADGAILVIESDVISRRFALNIKQQLERSGCRILGAVLNKVEMEGKGYYGHYY
GKYYKKYYG
SITEWalker A47/49GKS
SITEWalker A'67/74LMIDTDIR
SITEWalker B148/154VLIDCPP
SITE-145/-147YDY
SITEY Cluster214/231YYGHYYGKYYKKYYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKLNLGELRPLNFQGSESYKSLRTNIQFCGDDVKVIAFTSSIPNEGKSILVYRTSCSMAETGKKVLMIDTDIRKSVLVN
                                       TSSIPNEGKSILVYRTSCSMAETGKKVLMIDTDIRKSVLVN
                                              GKS                 LMIDTDIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLGIDKPGKGLSEYLSGQCSLDECLYETNVENLHMILTGPVAPNPSELLGSDRFKKLIAKARETYDYVLIDCPPLGSVID
RLGIDKPGKGLSEYLSGQCSLDECLYETNVENLHMILTGPVAPNPSELLGSDRFKKLIAKARETYDYVLIDCPPLGSVID
                                                                   VLIDCPP      
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
AAIVASAADGAILVIESDVISRRFALNIKQQLERSGCRILGAVLNKVEMEGKGYYGHYYGKYYKKYYGKYYGDKEHEEK
AAIVASAADGAILVIESDVISRRFALNIKQQLERSGCRILGAVLNKVEMEGKGYYGHYYGKYYKKYYG           
                                                     YYGHYYGKYYKKYYGKYY        
© 1998-2019