BYKdb

Annotate results for A0A1C5L1Z6

A0A1C5L1Z6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5L1Z6
DOMAINcd40/231TSCFPNEGKSDVVLSLAQELGSIGKKVLLLDADIRKTAYVGRLGVEEEVRGLSQFLSGQA
NINDIIYETNFENMDIIFGGPSAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVV
DAAVIGRYCDGAVFLIEPGNVRYKDAQRALSQLERSGCQILGAVMNKIDTKADKYYSFYY
KHYGEYYRRAEE
SITEWalker A47/49GKS
SITEWalker A'67/74LLLDADIR
SITEWalker B148/154ILIDTPP
SITE-144/-147YYSY
SITEY Cluster214/226YYSFYYKHYGEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKITLTDKRKNNYYYNEAIKTLRTNIQLSGQSIKTILITSCFPNEGKSDVVLSLAQELGSIGKKVLLLDADIRKTAYVG
                                       TSCFPNEGKSDVVLSLAQELGSIGKKVLLLDADIRKTAYVG
                                              GKS                 LLLDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLGVEEEVRGLSQFLSGQANINDIIYETNFENMDIIFGGPSAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVVD
RLGVEEEVRGLSQFLSGQANINDIIYETNFENMDIIFGGPSAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVVD
                                                                   ILIDTPP      
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
AAVIGRYCDGAVFLIEPGNVRYKDAQRALSQLERSGCQILGAVMNKIDTKADKYYSFYYKHYGEYYRRAEEENK
AAVIGRYCDGAVFLIEPGNVRYKDAQRALSQLERSGCQILGAVMNKIDTKADKYYSFYYKHYGEYYRRAEE   
                                                     YYSFYYKHYGEYY        
© 1998-2019