BYKdb

Annotate results for A0A1C5LM35

A0A1C5LM35 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5LM35
DOMAINcd40/234ISSTENEGKSFVAFHTWKQMAESGVHTLLLDTDLRKSVMAEKYQMEAENGKKLIGTSHVL
SKDMPLKDAVWHTIMPQGDILPNVENLVNPAMLLESETFHRLLNEASEEYRYIFIDAPPL
DLVSDGEKIGSLCDGAILVVASGKVSRGMVQNSIHQLERAGCPLLGIVLNRVEDQRKKNY
YQKYGYYASEKGKKK
SITEWalker A47/49GKS
SITEWalker A'67/74LLLDTDLR
SITEWalker B152/158IFIDAPP
SITE-149/-151YRY
SITEY Cluster219/226YYQKYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNKVQINNMPTLTYSTEEAINRLRVNLNFQAKDVKKIMVISSTENEGKSFVAFHTWKQMAESGVHTLLLDTDLRKSVMAE
                                       ISSTENEGKSFVAFHTWKQMAESGVHTLLLDTDLRKSVMAE
                                              GKS                 LLLDTDLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYQMEAENGKKLIGTSHVLSKDMPLKDAVWHTIMPQGDILPNVENLVNPAMLLESETFHRLLNEASEEYRYIFIDAPPLD
KYQMEAENGKKLIGTSHVLSKDMPLKDAVWHTIMPQGDILPNVENLVNPAMLLESETFHRLLNEASEEYRYIFIDAPPLD
                                                                       IFIDAPP  
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
LVSDGEKIGSLCDGAILVVASGKVSRGMVQNSIHQLERAGCPLLGIVLNRVEDQRKKNYYQKYGYYASEKGKKK
LVSDGEKIGSLCDGAILVVASGKVSRGMVQNSIHQLERAGCPLLGIVLNRVEDQRKKNYYQKYGYYASEKGKKK
                                                          YYQKYGYY        
© 1998-2019