BYKdb

Annotate results for A0A1C5MS04

A0A1C5MS04 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C5MS04
DOMAINtad7/148NNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDS
SVNISNSEFTQAKNLVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVF
YVYTYDSDPYRAMELANAIGRV
DOMAINcd277/465TSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMAVASLLKLRGRLGLSQYLAGLRE
TPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDAL
LLSHEVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYW
QEYKQQNGE
SITEWalker A284/286GKT
SITEWalker A'304/311LLIDGDMR
SITEWalker B382/388IIIDLPP
SITEY Cluster450/459YRLQQYWQEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
      NNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRV            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMAVASLLK
                                    TSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMAVASLLK
                                           GKT                 LLIDGDMR         
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
                                                             IIIDLPP            
       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGE  
                                                 YRLQQYWQEY        
© 1998-2019