BYKdb

Annotate results for A0A1C5N4W8

A0A1C5N4W8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5N4W8
DOMAINcd48/236TSSEMNEGKTTTVANIARCFSELDNKKTIVIDCDFRKQSINKYFRLSKNTKGLSDIIYEN
KELEICVQKDGDLDILCSGTFKANPAVLLQSSKMKKLIEYLKEKYDYILIDSPPVGRVND
ACIIAQYVDGTVVVAASKETEKSQVKVTKDRLEKVNANIIGVVLNKFKTNEYKSYSYYGY
YDYEDDRKF
SITEWalker A55/57GKT
SITEWalker A'76/83IVIDCDFR
SITEWalker B155/161ILIDSPP
SITE-147/-154YLKEKYDY
SITEY Cluster219/230YKSYSYYGYYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNKKKNDVSRYDNVAKYNDGNYEINEAYRGIRTFLTVDENIKTILITSSEMNEGKTTTVANIARCFSELDNKKTIVIDC
                                               TSSEMNEGKTTTVANIARCFSELDNKKTIVIDC
                                                      GKT                  IVIDC
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DFRKQSINKYFRLSKNTKGLSDIIYENKELEICVQKDGDLDILCSGTFKANPAVLLQSSKMKKLIEYLKEKYDYILIDSP
DFRKQSINKYFRLSKNTKGLSDIIYENKELEICVQKDGDLDILCSGTFKANPAVLLQSSKMKKLIEYLKEKYDYILIDSP
DFR                                                                       ILIDSP
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVGRVNDACIIAQYVDGTVVVAASKETEKSQVKVTKDRLEKVNANIIGVVLNKFKTNEYKSYSYYGYYDYEDDRKFRLFK
PVGRVNDACIIAQYVDGTVVVAASKETEKSQVKVTKDRLEKVNANIIGVVLNKFKTNEYKSYSYYGYYDYEDDRKF    
P                                                         YKSYSYYGYYDY          
     
....:
NKRRA


© 1998-2019