BYKdb

Annotate results for A0A1C5N6D6

A0A1C5N6D6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5N6D6
DOMAINcd39/230TSCTPNEGKSTVTLALAQSLAEAGKKVLFIDADLRKSVLAGRHKVHGQLKGLSHFLSGQT
ELGEVMYRVKDTNMVMIFAGVVPPNPAELLGGKRFESLLTSARKAYDYVIIDAPPLGSVI
DAAIIAKQSDASVLVISANTVSHKFAKVVKEQLEKSGCPILGVVLNKVDMAQNKYYGKYY
GTYGDYGRVEEG
SITEWalker A46/48GKS
SITEWalker A'66/73LFIDADLR
SITEWalker B147/153VIIDAPP
SITE-144/-146YDY
SITEY Cluster213/224YYGKYYGTYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQEIELKEIKKDYRSNEAYKSLRTNIEFSGEDNKVLVFTSCTPNEGKSTVTLALAQSLAEAGKKVLFIDADLRKSVLAGR
                                      TSCTPNEGKSTVTLALAQSLAEAGKKVLFIDADLRKSVLAGR
                                             GKS                 LFIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKVHGQLKGLSHFLSGQTELGEVMYRVKDTNMVMIFAGVVPPNPAELLGGKRFESLLTSARKAYDYVIIDAPPLGSVIDA
HKVHGQLKGLSHFLSGQTELGEVMYRVKDTNMVMIFAGVVPPNPAELLGGKRFESLLTSARKAYDYVIIDAPPLGSVIDA
                                                                  VIIDAPP       
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
AIIAKQSDASVLVISANTVSHKFAKVVKEQLEKSGCPILGVVLNKVDMAQNKYYGKYYGTYGDYGRVEEGKV
AIIAKQSDASVLVISANTVSHKFAKVVKEQLEKSGCPILGVVLNKVDMAQNKYYGKYYGTYGDYGRVEEG  
                                                    YYGKYYGTYGDY        
© 1998-2019