BYKdb

Annotate results for A0A1C5P379

A0A1C5P379 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C5P379
DOMAINtad3/161KNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQ
DKTNVDLQDINASKSLVQTYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSND
GLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMADV
DOMAINcd298/486SSPNPSEGKSVTVANLAASMAETENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGEST
FDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQHKYDYVIVDGTPLLPVTD
VMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYRYKYS
YKYKYDYSY
SITEWalker A305/307GKS
SITEWalker A'325/332LLIDADMR
SITEWalker B405/411VIVDGTP
SITE-397/-439YVQHKYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTY
SITEY Cluster472/488YRYKYSYKYKYDYSYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
  KNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
V                                                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
                                                         SSPNPSEGKSVTVANLAASMAET
                                                                GKS             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
    LLIDADMR                                                                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYRYKYSYKY
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYRYKYSYKY
    VIVDGTP                                                            YRYKYSYKY
       490       
....:....|....:..
KYDYSYKYGGKDTSAES
KYDYSY           
KYDYSYKY         
© 1998-2019