BYKdb

Annotate results for A0A1C5Q1F3

A0A1C5Q1F3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C5Q1F3
DOMAINtad30/275HTLHVGDWLHIALANWKWFVLSLVVCMGASFWYIKRSPDIYSRSASVLIKDETRGAQLPN
AASAFSEMDLLNIQSTVDNEVLIFKSKRLMIEVARKLKLDIFYSVKGKFRDWDLYTTSPV
TLTFPEALETSSFSFKVTPLNDKEVLLSDFPEMEGVKPVEQMKVHLNDTVATPVGKLVVT
PTLYYTQDYYQVPVTVNKMNLEKVGMAYNAALQSMVASKTSSIIHLSISDVSPRRAEDIL
NTLIDV
DOMAINcd613/805TSFHVGDGKTFVSSNLAMTLALAGYKVVLVDLDIRKGTLSKHMGGSQQVGVTNFLAGTVD
RVDDLLMPSGCHENLSLVCKGPVPPNPSELLLNARLNVLIRHLKERFDYVILDNVPSHMV
ADALIVNRVADLTLYVIRAGGMDRRQLPEIELLHTEHKLKNMALVLNGVNRQRDSYGYYG
YYGYYQYGYKEEK
SITEWalker A620/622GKT
SITEWalker A'640/647VLVDLDIR
SITEWalker B722/728VILDNVP
SITEY Cluster788/801YGYYGYYGYYQYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLRDFGFNFNCHLNIGCEMTNRKNTQSDHTLHVGDWLHIALANWKWFVLSLVVCMGASFWYIKRSPDIYSRSASVLIKD
                             HTLHVGDWLHIALANWKWFVLSLVVCMGASFWYIKRSPDIYSRSASVLIKD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETRGAQLPNAASAFSEMDLLNIQSTVDNEVLIFKSKRLMIEVARKLKLDIFYSVKGKFRDWDLYTTSPVTLTFPEALETS
ETRGAQLPNAASAFSEMDLLNIQSTVDNEVLIFKSKRLMIEVARKLKLDIFYSVKGKFRDWDLYTTSPVTLTFPEALETS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFSFKVTPLNDKEVLLSDFPEMEGVKPVEQMKVHLNDTVATPVGKLVVTPTLYYTQDYYQVPVTVNKMNLEKVGMAYNAA
SFSFKVTPLNDKEVLLSDFPEMEGVKPVEQMKVHLNDTVATPVGKLVVTPTLYYTQDYYQVPVTVNKMNLEKVGMAYNAA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQSMVASKTSSIIHLSISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIADYKSQH
LQSMVASKTSSIIHLSISDVSPRRAEDILNTLIDV                                             

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLADISTQTGSFMERSNRYQQEGVTLENQRTLALYIRDYLADPAKSGELIPSNTGISDGTIERQIMEYNELMLQRDKLIG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSSNKNPVVMDMNNSLASMKQTIVRTVDNLIAGLDMKIQNIRGEEERAMKRIAAVPSQQKYVLSVERQQKIKESLYIYLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKREENALTKSITESNARIIDPAMGSSVPVSPKTHLIMLAGFMLGLLLPACVLFVLRTSDTKVRGKKDLTDVLSIPFLGE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPRREREKGEGNRSVVVTEEGKDAVSEAFRILRTNMAFMSGAADGKLQTLMVTSFHVGDGKTFVSSNLAMTLALAGYKVV
                                                    TSFHVGDGKTFVSSNLAMTLALAGYKVV
                                                           GKT                 V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDLDIRKGTLSKHMGGSQQVGVTNFLAGTVDRVDDLLMPSGCHENLSLVCKGPVPPNPSELLLNARLNVLIRHLKERFD
LVDLDIRKGTLSKHMGGSQQVGVTNFLAGTVDRVDDLLMPSGCHENLSLVCKGPVPPNPSELLLNARLNVLIRHLKERFD
LVDLDIR                                                                         
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVILDNVPSHMVADALIVNRVADLTLYVIRAGGMDRRQLPEIELLHTEHKLKNMALVLNGVNRQRDSYGYYGYYGYYQYG
YVILDNVPSHMVADALIVNRVADLTLYVIRAGGMDRRQLPEIELLHTEHKLKNMALVLNGVNRQRDSYGYYGYYGYYQYG
 VILDNVP                                                           YGYYGYYGYYQYG
     
....:
YKEEK
YKEEK
Y    

© 1998-2019