BYKdb

Annotate results for A0A1C5QYH5

A0A1C5QYH5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5QYH5
DOMAINcd39/228TSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASKLQITGADKGLSHFLSGQC
VLADVIMATNIPKFHILLSGPEAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVI
DAAIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLDNSGVSVLGVVLNKVERKNQKGYYNKY
YGSQKYEGYY
SITE-177/-179GKT
SITEWalker A'66/73ILVDADIR
SITEWalker B147/153IIIDCPP
SITE-144/-146YDY
SITEY Cluster214/228YYNKYYGSQKYEGYY
SITEWalker A46/48GKS
SITE-62/-64GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKVNLSIEKKSYGVREAIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
                                      TSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
                                             GKS                 ILVDADIR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
                                                                  IIIDCPP       
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLDNSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYYGHNEETKNA
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLDNSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYY         
                                                     YYNKYYGSQKYEGYY         
© 1998-2019