BYKdb

Annotate results for A0A1C5TAU5

A0A1C5TAU5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5TAU5
DOMAINcd39/231TSSLPNEGKSTISMNLWKMMAEAGFPTVFLDVDLRKSVIKSRHNIQTEGEIKDLGYYLSG
QAEYEDVVYETNIPNGYIVPCCNLLENPSALLEDDRFAELLNKLAEQYRYVIIDSPPLGS
VADAAQVASLCDGAVLVVRSGETSRNVIKQSMQQLEQVRCKLLGVILNRVEVSGRAYKSY
YGKYKSYGYGYGY
SITEWalker A46/48GKS
SITEWalker A'66/73VFLDVDLR
SITEWalker B149/155VIIDSPP
SITE-94/-148YYLSGQAEYEDVVYETNIPNGYIVPCCNLLENPSALLEDDRFAELLNKLAEQYRY
SITEY Cluster215/231YKSYYGKYKSYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKINIDFKEMPYAVEEAMNRLRINIKFCGKNTKKLLITSSLPNEGKSTISMNLWKMMAEAGFPTVFLDVDLRKSVIKSR
                                      TSSLPNEGKSTISMNLWKMMAEAGFPTVFLDVDLRKSVIKSR
                                             GKS                 VFLDVDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNIQTEGEIKDLGYYLSGQAEYEDVVYETNIPNGYIVPCCNLLENPSALLEDDRFAELLNKLAEQYRYVIIDSPPLGSVA
HNIQTEGEIKDLGYYLSGQAEYEDVVYETNIPNGYIVPCCNLLENPSALLEDDRFAELLNKLAEQYRYVIIDSPPLGSVA
                                                                    VIIDSPP     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
DAAQVASLCDGAVLVVRSGETSRNVIKQSMQQLEQVRCKLLGVILNRVEVSGRAYKSYYGKYKSYGYGYGYGKDQKSGK
DAAQVASLCDGAVLVVRSGETSRNVIKQSMQQLEQVRCKLLGVILNRVEVSGRAYKSYYGKYKSYGYGYGY        
                                                      YKSYYGKYKSYGYGYGY        
© 1998-2019