BYKdb

Annotate results for A0A1C5TSB8

A0A1C5TSB8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C5TSB8
DOMAINtad11/154LEIDLGILLWNFLQGLARFWWLVILLAALGSAAYYVKNSQFYTPMYQSVASFTVMTGGNS
ENGQEEGSYNFYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLGVDSINGSISAQAVSDSN
LITMTVTSSDPQDAKAILESAIKV
DOMAINcd286/475TSTISGEGKSTVALNMAYAAALHEKKVLFIDADLRKQTDRRCLTETEGKGLYGVVTGKCS
LEKAVEKDGRSGISFLCGSLPVRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPAEMFED
ASLMAEFSDGICYVIRHDFVQKRRILESLAGLESSGTTILGYAFNGVPLHKGRYGYYGYG
RYGYGYYGKY
SITEWalker A293/295GKS
SITEWalker A'313/320LFIDADLR
SITEWalker B393/399VILDSPP
SITEY Cluster459/477YGYYGYGRYGYGYYGKYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDERLEDREELEIDLGILLWNFLQGLARFWWLVILLAALGSAAYYVKNSQFYTPMYQSVASFTVMTGGNSENGQEEGSYN
          LEIDLGILLWNFLQGLARFWWLVILLAALGSAAYYVKNSQFYTPMYQSVASFTVMTGGNSENGQEEGSYN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLGVDSINGSISAQAVSDSNLITMTVTSSDPQDAKAILESAIKVYPEVSR
FYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLGVDSINGSISAQAVSDSNLITMTVTSSDPQDAKAILESAIKV      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVIGETKFNMIDVPTAPKEPYNQPNFVKKAVKGALLGAAAGIFLIVLYAFFRKTVQTPDELKNVMSLPCLGNLPEMKQKA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKKKRRRDISILNKEFSQRFKESLLSIELKAERELQDKNGKILLVTSTISGEGKSTVALNMAYAAALHEKKVLFIDADLR
                                             TSTISGEGKSTVALNMAYAAALHEKKVLFIDADLR
                                                    GKS                 LFIDADLR
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQTDRRCLTETEGKGLYGVVTGKCSLEKAVEKDGRSGISFLCGSLPVRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPA
KQTDRRCLTETEGKGLYGVVTGKCSLEKAVEKDGRSGISFLCGSLPVRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPA
                                                                        VILDSPP 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGLESSGTTILGYAFNGVPLHKGRYGYYGYGRYGYGYYGKYGYGEQ
EMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGLESSGTTILGYAFNGVPLHKGRYGYYGYGRYGYGYYGKY     
                                                          YGYYGYGRYGYGYYGKYGY   
      
....:.
DEETQS


© 1998-2019