BYKdb

Annotate results for A0A1C5TVM6

A0A1C5TVM6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5TVM6
DOMAINcd39/229TSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGRVHVEEEVMGLTHYLSKQA
KLSDVICATNLPKFHIIFSGVVPPNPAELLGSRLFKDMIRLVRDVYDYIIVDTPPLGRVI
DCAVVADSCDGTVIVIESGSISYHFVQDIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYG
KYGKYGEYGKY
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDADLR
SITEWalker B147/153IIVDTPP
SITE-144/-146YDY
SITE-62/-64GKS
SITEY Cluster211/229YGKYGKYGKYGKYGEYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVKVKISDWKADTSMDEAYKALRTNIQFCGADKKVIAFTSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
                                      TSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
                                             GKS                 LLIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHVEEEVMGLTHYLSKQAKLSDVICATNLPKFHIIFSGVVPPNPAELLGSRLFKDMIRLVRDVYDYIIVDTPPLGRVIDC
VHVEEEVMGLTHYLSKQAKLSDVICATNLPKFHIIFSGVVPPNPAELLGSRLFKDMIRLVRDVYDYIIVDTPPLGRVIDC
                                                                  IIVDTPP       
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
AVVADSCDGTVIVIESGSISYHFVQDIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGEYGKY
AVVADSCDGTVIVIESGSISYHFVQDIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGEYGKY
                                                  YGKYGKYGKYGKYGEYGKY
© 1998-2019