BYKdb

Annotate results for A0A1C5U0M6

A0A1C5U0M6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5U0M6
DOMAINcd43/232TSCYPNEGKSDIAFQLAREIGNMGKKVLFLDADIRKSMLVSRYKVKQKGITGLSHYLCGQ
TDPEYLCYESNFPNLDIIFAGRSVPNPSELLEDEAMGNLIQSLRSRYDFIILDAPPVLSV
SDALIAAKWCDGVLLVVESKKVSYKALQRVKKQLEQTGCRILGAVLNKVDMQQDTYYSKY
YGHYGYYNGY
SITEWalker A50/52GKS
SITEWalker A'70/77LFLDADIR
SITEWalker B152/158IILDAPP
SITE-107/-110YLCY
SITEY Cluster218/232YYSKYYGHYGYYNGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASDRKVVMIDPKKADSLYEEAIKTLRTNLQFTGRGIQVILATSCYPNEGKSDIAFQLAREIGNMGKKVLFLDADIRKSM
                                          TSCYPNEGKSDIAFQLAREIGNMGKKVLFLDADIRKSM
                                                 GKS                 LFLDADIR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVSRYKVKQKGITGLSHYLCGQTDPEYLCYESNFPNLDIIFAGRSVPNPSELLEDEAMGNLIQSLRSRYDFIILDAPPVL
LVSRYKVKQKGITGLSHYLCGQTDPEYLCYESNFPNLDIIFAGRSVPNPSELLEDEAMGNLIQSLRSRYDFIILDAPPVL
                                                                       IILDAPP  
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
SVSDALIAAKWCDGVLLVVESKKVSYKALQRVKKQLEQTGCRILGAVLNKVDMQQDTYYSKYYGHYGYYNGYGNTK
SVSDALIAAKWCDGVLLVVESKKVSYKALQRVKKQLEQTGCRILGAVLNKVDMQQDTYYSKYYGHYGYYNGY    
                                                         YYSKYYGHYGYYNGY    
© 1998-2019