BYKdb

Annotate results for A0A1C5U2R6

A0A1C5U2R6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5U2R6
DOMAINcd39/232TSCLPNEGKSTVSSYLWKMLAEAGFPTVLVDADLRKSVMRKRLQIEYKEDVRGLNHYLSG
MAEYDEVVYQTNVANGYLVPCTQLLESPSALLEDSRFRDLLNTLAENYRFVIIDTPPLGS
VSDSALIASMCDGAVLVIRAGVTPKGMIKQSLFELEQVNCKLLGTVLNRAEVHSRAYGKY
YSKYYGKYGKKYGY
SITEWalker A46/48GKS
SITEWalker A'66/73VLVDADLR
SITEWalker B149/155VIIDTPP
SITE-102/-107YDEVVY
SITEY Cluster215/236YGKYYSKYYGKYGKKYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQLTITLPELPYAVEEAMNRLRINIKFCGKNTRKILLTSCLPNEGKSTVSSYLWKMLAEAGFPTVLVDADLRKSVMRKR
                                      TSCLPNEGKSTVSSYLWKMLAEAGFPTVLVDADLRKSVMRKR
                                             GKS                 VLVDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQIEYKEDVRGLNHYLSGMAEYDEVVYQTNVANGYLVPCTQLLESPSALLEDSRFRDLLNTLAENYRFVIIDTPPLGSVS
LQIEYKEDVRGLNHYLSGMAEYDEVVYQTNVANGYLVPCTQLLESPSALLEDSRFRDLLNTLAENYRFVIIDTPPLGSVS
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSALIASMCDGAVLVIRAGVTPKGMIKQSLFELEQVNCKLLGTVLNRAEVHSRAYGKYYSKYYGKYGKKYGYGYGYGKEE
DSALIASMCDGAVLVIRAGVTPKGMIKQSLFELEQVNCKLLGTVLNRAEVHSRAYGKYYSKYYGKYGKKYGY        
                                                      YGKYYSKYYGKYGKKYGYGYGY    
      
....:.
KPDAGK


© 1998-2019