BYKdb

Annotate results for A0A1C5WD38

A0A1C5WD38 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5WD38
DOMAINcd58/247TSCYPNEGKSDIVSQLAKEMGKAGKKVLLLDADIRKSTFIQRFQIEGEIKGLSQYLSGQV
AVRDILYTTNYENVDMIFAGPVAPNPSELLEGKLFAHLVEGLSQRYDYILIDTPPMASVI
DAAIVGGVCDGAILVIEDGAVGYRTAQKVKAQLEKSGSRVLGAVLNKVEMKKGKYYSYDK
YGKYSKYGRY
SITEWalker A65/67GKS
SITEWalker A'85/92LLLDADIR
SITEWalker B166/172ILIDTPP
SITE-124/-165YTTNYENVDMIFAGPVAPNPSELLEGKLFAHLVEGLSQRYDY
SITEY Cluster232/250YYSYDKYGKYSKYGRYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQARRSQRSDARQQTRVRPSVTMVDQRKENYHYEEALKTLRTNIQFAGAEITSILVTSCYPNEGKSDIVSQLAKEMGKA
                                                         TSCYPNEGKSDIVSQLAKEMGKA
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKVLLLDADIRKSTFIQRFQIEGEIKGLSQYLSGQVAVRDILYTTNYENVDMIFAGPVAPNPSELLEGKLFAHLVEGLS
GKKVLLLDADIRKSTFIQRFQIEGEIKGLSQYLSGQVAVRDILYTTNYENVDMIFAGPVAPNPSELLEGKLFAHLVEGLS
    LLLDADIR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRYDYILIDTPPMASVIDAAIVGGVCDGAILVIEDGAVGYRTAQKVKAQLEKSGSRVLGAVLNKVEMKKGKYYSYDKYGK
QRYDYILIDTPPMASVIDAAIVGGVCDGAILVIEDGAVGYRTAQKVKAQLEKSGSRVLGAVLNKVEMKKGKYYSYDKYGK
     ILIDTPP                                                           YYSYDKYGK
       250
....:....|
YSKYGRYGKY
YSKYGRY   
YSKYGRYGKY
© 1998-2019