BYKdb

Annotate results for A0A1C5WZV1

A0A1C5WZV1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5WZV1
DOMAINcd39/229TSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGRVQVEEEVKGLTHYLSKQA
KLQDVICATNLPKFHIIFSGVVPPNPAELLGSRQFKDMIRVVRDVYDYIIIDTPPLGRVI
DCAVVADSCDGTVIVIESGSISYHFVQEIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYG
KYGKYGKYGEY
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDADLR
SITEWalker B147/153IIIDTPP
SITE-144/-146YDY
SITE-62/-64GKS
SITEY Cluster211/232YGKYGKYGKYGKYGKYGEYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVKVKISDWKADSSMDEAYKALRTNIQFCGADKKVIAFTSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
                                      TSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
                                             GKS                 LLIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQVEEEVKGLTHYLSKQAKLQDVICATNLPKFHIIFSGVVPPNPAELLGSRQFKDMIRVVRDVYDYIIIDTPPLGRVIDC
VQVEEEVKGLTHYLSKQAKLQDVICATNLPKFHIIFSGVVPPNPAELLGSRQFKDMIRVVRDVYDYIIIDTPPLGRVIDC
                                                                  IIIDTPP       
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
AVVADSCDGTVIVIESGSISYHFVQEIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGKYGEYGKY
AVVADSCDGTVIVIESGSISYHFVQEIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGKYGEY   
                                                  YGKYGKYGKYGKYGKYGEYGKY
© 1998-2019