BYKdb

Annotate results for A0A1C5X1G3

A0A1C5X1G3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5X1G3
DOMAINcd41/232TSCTPNEGKSSVAMEMARAFAEAGSKTMLIDADMRKSVLVGRYKTGAVRKGLTHCLIGKA
NYLEVMCETNVPNLYVTFSGPVPPNPSELLGGEKFRSILNVLRSSFDYVIVDTPPLGSVI
DAAVAAKSCDGTVLVIESNAISYRFAQKVKEQLDKTGSRILGVVLNKVDMNGKGYYGHYG
KYYGKYYGKYYG
SITEWalker A48/50GKS
SITEWalker A'68/75MLIDADMR
SITEWalker B149/155VIVDTPP
SITEY Cluster215/234YYGHYGKYYGKYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNVKLQFEKKNNDYRIREAFKTLRSNIEFCGGDVKVIAVTSCTPNEGKSSVAMEMARAFAEAGSKTMLIDADMRKSVLV
                                        TSCTPNEGKSSVAMEMARAFAEAGSKTMLIDADMRKSVLV
                                               GKS                 MLIDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRYKTGAVRKGLTHCLIGKANYLEVMCETNVPNLYVTFSGPVPPNPSELLGGEKFRSILNVLRSSFDYVIVDTPPLGSVI
GRYKTGAVRKGLTHCLIGKANYLEVMCETNVPNLYVTFSGPVPPNPSELLGGEKFRSILNVLRSSFDYVIVDTPPLGSVI
                                                                    VIVDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAVAAKSCDGTVLVIESNAISYRFAQKVKEQLDKTGSRILGVVLNKVDMNGKGYYGHYGKYYGKYYGKYYGNYGSETAS
DAAVAAKSCDGTVLVIESNAISYRFAQKVKEQLDKTGSRILGVVLNKVDMNGKGYYGHYGKYYGKYYGKYYG        
                                                      YYGHYGKYYGKYYGKYYGNY      
       250       260       270       280       
....:....|....:....|....:....|....:....|....:..
RQEKSSLENEVRQFRDDMVEDPEKGRAAQKISEAGKDPEDIEFIEDI


© 1998-2019