BYKdb

Annotate results for A0A1C5XEE7

A0A1C5XEE7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5XEE7
DOMAINcd38/224TSSCANEGKSTVAFHLAQVYAAKYKKVLVIDCDLRRPKMHRYFQISNQVGLSDLLVFIDK
QPDLSTYIQEVTVTDCENAISVLTSGSKVPNPQELLGSSKFKKLLQALSKQYDFIILDCP
PISMISDTFYVSNVSDGTIFVISMKDTKKDIALSSIRQLERSRSKILGIVLTKTQNLSSY
DYYYTYE
SITEWalker A45/47GKS
SITEWalker A'65/72LVIDCDLR
SITEWalker B152/158IILDCPP
SITE-57/-61YAAKY
SITE-93/-99VFIDKQP
SITEY Cluster217/223YDYYYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKNKNTYKFDNMEAFRKLKTNIEFSAVEKPIKVVNITSSCANEGKSTVAFHLAQVYAAKYKKVLVIDCDLRRPKMHRYF
                                     TSSCANEGKSTVAFHLAQVYAAKYKKVLVIDCDLRRPKMHRYF
                                            GKS                 LVIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QISNQVGLSDLLVFIDKQPDLSTYIQEVTVTDCENAISVLTSGSKVPNPQELLGSSKFKKLLQALSKQYDFIILDCPPIS
QISNQVGLSDLLVFIDKQPDLSTYIQEVTVTDCENAISVLTSGSKVPNPQELLGSSKFKKLLQALSKQYDFIILDCPPIS
                                                                       IILDCPP  
       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
MISDTFYVSNVSDGTIFVISMKDTKKDIALSSIRQLERSRSKILGIVLTKTQNLSSYDYYYTYE
MISDTFYVSNVSDGTIFVISMKDTKKDIALSSIRQLERSRSKILGIVLTKTQNLSSYDYYYTYE
                                                        YDYYYTY 
© 1998-2019