BYKdb

Annotate results for A0A1C5XJA7

A0A1C5XJA7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C5XJA7
DOMAINtad12/250QNINLLDLLMYLASKWKWFIMSVLIFGGIAWYKYATAPLVYFGSATVIIKDPSSKTTTTG
LDRFDNFINKVNVANEMLQFNSKRLIREVVSRTHADVSYKMKDGLRNVELYTKSPVAVSF
ADMLPEQYVAFTVTLLNKDSVEITDFSMAENGERQVVELNDTISLNEGKVVVVPTNYMTE
SWIGVPVKVSKMPLDAVVSVYRNSIAVKQEEEESSILTLALKDNSSERAEDILNMLVNV
DOMAINcd587/776TSFNSGAGKSFVAFNLADSLAYTKKKVILIDLDIRKGSLSHRMHKHGVGMTNYLADETIA
LDDIIHDCGKDYDFINAGTSAPNPAELLMDSRLDSMMEELRKRYDYIVVDNVPVGLVADA
TIANRIADITIFVVRAGRLDKRQLPDIEKLYQEKVLNNMALILNGADLERHGYGYGSYGY
GYGYGYGNNK
SITEWalker A594/596GKS
SITEWalker A'614/621ILIDLDIR
SITEWalker B693/699IVVDNVP
SITE-690/-692YDY
SITEY Cluster759/772YGYGSYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNNIQSNKNDQNINLLDLLMYLASKWKWFIMSVLIFGGIAWYKYATAPLVYFGSATVIIKDPSSKTTTTGLDRFDNFIN
           QNINLLDLLMYLASKWKWFIMSVLIFGGIAWYKYATAPLVYFGSATVIIKDPSSKTTTTGLDRFDNFIN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVNVANEMLQFNSKRLIREVVSRTHADVSYKMKDGLRNVELYTKSPVAVSFADMLPEQYVAFTVTLLNKDSVEITDFSMA
KVNVANEMLQFNSKRLIREVVSRTHADVSYKMKDGLRNVELYTKSPVAVSFADMLPEQYVAFTVTLLNKDSVEITDFSMA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENGERQVVELNDTISLNEGKVVVVPTNYMTESWIGVPVKVSKMPLDAVVSVYRNSIAVKQEEEESSILTLALKDNSSERA
ENGERQVVELNDTISLNEGKVVVVPTNYMTESWIGVPVKVSKMPLDAVVSVYRNSIAVKQEEEESSILTLALKDNSSERA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIGQELGDVESDLESFKRENQTLDISSSASMYMGESQKYNSSALE
EDILNMLVNV                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LETQLRLAQYIKEYLTDPKKEADLIPSNTGISDMNIENQIGMYNAAKLKRDRLISDSSDKNPVVEELNSSLRAMKQSIIR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVDNMIVSINVKRNDAQNREMRVQERLSAMPTKERQMLSIERQQKIKESLYLFLLNKREENALSQAMADNNARVIDSAEA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKYPISPNRNKILALGILLGLALPTVSFLVIMFMDTRIHSRKDILGAVSVPFLGEIPLDKNYKSSRKGAANAYGYGDNVV


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEAFRILRTNMSFMAKKDRPLQVITFTSFNSGAGKSFVAFNLADSLAYTKKKVILIDLDIRKGSLSHRMHKHGVGMTNYL
                          TSFNSGAGKSFVAFNLADSLAYTKKKVILIDLDIRKGSLSHRMHKHGVGMTNYL
                                 GKS                 ILIDLDIR                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADETIALDDIIHDCGKDYDFINAGTSAPNPAELLMDSRLDSMMEELRKRYDYIVVDNVPVGLVADATIANRIADITIFVV
ADETIALDDIIHDCGKDYDFINAGTSAPNPAELLMDSRLDSMMEELRKRYDYIVVDNVPVGLVADATIANRIADITIFVV
                                                    IVVDNVP                     
       730       740       750       760       770        
....:....|....:....|....:....|....:....|....:....|....:...
RAGRLDKRQLPDIEKLYQEKVLNNMALILNGADLERHGYGYGSYGYGYGYGYGNNKNK
RAGRLDKRQLPDIEKLYQEKVLNNMALILNGADLERHGYGYGSYGYGYGYGYGNNK  
                                      YGYGSYGYGYGYGY      

© 1998-2019