BYKdb

Annotate results for A0A1C5XR76

A0A1C5XR76 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5XR76
DOMAINcd39/229TSCTPNEGKSSVAFNLAASLAESGKSVLLIDADLRKSVLMGRVTVDQEVMGLAHYLSKQA
KLSDVICATTLPKFHIIFSGIVPPNPAELLGNRLFKDMIRVVRDVYDYVIVDTPPLGLII
DSAIIADSCDGSVIVVESGTISYRFVQEVRDQLAKSNCPILGTILNKVDYSKAGNYGHYG
KYGKYGKYGKY
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDADLR
SITEWalker B147/153VIVDTPP
SITE-144/-146YDY
SITE-62/-64GKS
SITEY Cluster208/235YSKAGNYGHYGKYGKYGKYGKYGSYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIKVKLSNWKSDHQMDEAYKALRTNIQFCGADKKVIALTSCTPNEGKSSVAFNLAASLAESGKSVLLIDADLRKSVLMGR
                                      TSCTPNEGKSSVAFNLAASLAESGKSVLLIDADLRKSVLMGR
                                             GKS                 LLIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTVDQEVMGLAHYLSKQAKLSDVICATTLPKFHIIFSGIVPPNPAELLGNRLFKDMIRVVRDVYDYVIVDTPPLGLIIDS
VTVDQEVMGLAHYLSKQAKLSDVICATTLPKFHIIFSGIVPPNPAELLGNRLFKDMIRVVRDVYDYVIVDTPPLGLIIDS
                                                                  VIVDTPP       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIIADSCDGSVIVVESGTISYRFVQEVRDQLAKSNCPILGTILNKVDYSKAGNYGHYGKYGKYGKYGKYGSYGDYGESSS
AIIADSCDGSVIVVESGTISYRFVQEVRDQLAKSNCPILGTILNKVDYSKAGNYGHYGKYGKYGKYGKY           
                                               YSKAGNYGHYGKYGKYGKYGKYGSYGDY     
 
.
K


© 1998-2019