BYKdb

Annotate results for A0A1C5YMF0

A0A1C5YMF0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5YMF0
DOMAINcd39/231TSCTPNEGKSSVTMNLAVSMAEAGKKVILIDADMRKSVLVGRTKVRSSVKGLTHYLSKQA
PLIDVICSTNVKNLSIIFAGPVPPNPAELLGSRHFKAMLDSLKKVYDYILIDTPPLGSVI
DSAIIAEECDGAMIVIESGVISYRFAQDVKQQLEKSNCPILGVVLNKVDMSRQGYYGKYY
GKYYGKYGKYGKY
SITEWalker A46/48GKS
SITEWalker A'66/73ILIDADMR
SITEWalker B147/153ILIDTPP
SITE-144/-146YDY
SITEY Cluster213/231YYGKYYGKYYGKYGKYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENVEIKVQEMDYSGTEAYKSLRTNLQFCGEDKKVIAVTSCTPNEGKSSVTMNLAVSMAEAGKKVILIDADMRKSVLVGR
                                      TSCTPNEGKSSVTMNLAVSMAEAGKKVILIDADMRKSVLVGR
                                             GKS                 ILIDADMR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TKVRSSVKGLTHYLSKQAPLIDVICSTNVKNLSIIFAGPVPPNPAELLGSRHFKAMLDSLKKVYDYILIDTPPLGSVIDS
TKVRSSVKGLTHYLSKQAPLIDVICSTNVKNLSIIFAGPVPPNPAELLGSRHFKAMLDSLKKVYDYILIDTPPLGSVIDS
                                                                  ILIDTPP       
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
AIIAEECDGAMIVIESGVISYRFAQDVKQQLEKSNCPILGVVLNKVDMSRQGYYGKYYGKYYGKYGKYGKYGHED
AIIAEECDGAMIVIESGVISYRFAQDVKQQLEKSNCPILGVVLNKVDMSRQGYYGKYYGKYYGKYGKYGKY    
                                                    YYGKYYGKYYGKYGKYGKY    
© 1998-2019