BYKdb

Annotate results for A0A1C5YQC9

A0A1C5YQC9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C5YQC9
DOMAINcd39/228TSSGQNEGKSTAISNIAASFASLENKKVLLIDCDLRNPTVHKMFGVSNINGITDVLTGQK
DVEKCIENTKVSNLDILKVGKIPPNPSEMLQSKRMKSFMEAIKPHYDYIFIDAPPVGIVT
DASILAQYVDGTILLVAANEADIEATKIAKERLESVNANILGAVLNKFEADEKSYGYYNY
YYGSSSEKRK
SITEWalker A46/48GKS
SITEWalker A'67/74LLIDCDLR
SITEWalker B147/153IFIDAPP
SITE-144/-146YDY
SITEY Cluster213/220YGYYNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQLHIHRNPKSHISEAYRLLRTNIEFSNIDKNLKTILITSSGQNEGKSTAISNIAASFASLENKKVLLIDCDLRNPTVHK
                                      TSSGQNEGKSTAISNIAASFASLENKKVLLIDCDLRNPTVHK
                                             GKS                  LLIDCDLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFGVSNINGITDVLTGQKDVEKCIENTKVSNLDILKVGKIPPNPSEMLQSKRMKSFMEAIKPHYDYIFIDAPPVGIVTDA
MFGVSNINGITDVLTGQKDVEKCIENTKVSNLDILKVGKIPPNPSEMLQSKRMKSFMEAIKPHYDYIFIDAPPVGIVTDA
                                                                  IFIDAPP       
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
SILAQYVDGTILLVAANEADIEATKIAKERLESVNANILGAVLNKFEADEKSYGYYNYYYGSSSEKRKPKRGLFGRK
SILAQYVDGTILLVAANEADIEATKIAKERLESVNANILGAVLNKFEADEKSYGYYNYYYGSSSEKRK         
                                                    YGYYNYYY                 
© 1998-2019