BYKdb

Annotate results for A0A1C6AJD6

A0A1C6AJD6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6AJD6
DOMAINcd37/225TSAEMDEGKTTIICNLAKCFSELEGVRVLLIDCDFRKRGVSRYFGIENSFGVSDIVFGNN
KKSECIKKVGDLDIITSGGVPSNTSILLNSQSMKDLVSKLREEYDYVFIDSPPICRLNDA
CIITQYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAEKYSYYSNYYGY
SNYYGEHKH
SITEWalker A44/46GKT
SITEWalker A'65/72LLIDCDFR
SITEWalker B143/149VFIDSPP
SITE-140/-142YDY
SITEY Cluster207/220YSYYSNYYGYSNYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKRGAYDEGNFELNESYREIRTYVTINKNIKTILVTSAEMDEGKTTIICNLAKCFSELEGVRVLLIDCDFRKRGVSRYF
                                    TSAEMDEGKTTIICNLAKCFSELEGVRVLLIDCDFRKRGVSRYF
                                           GKT                  LLIDCDFR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIENSFGVSDIVFGNNKKSECIKKVGDLDIITSGGVPSNTSILLNSQSMKDLVSKLREEYDYVFIDSPPICRLNDACIIT
GIENSFGVSDIVFGNNKKSECIKKVGDLDIITSGGVPSNTSILLNSQSMKDLVSKLREEYDYVFIDSPPICRLNDACIIT
                                                              VFIDSPP           
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
QYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAEKYSYYSNYYGYSNYYGEHKHKLFGRKKKRRRKTS
QYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAEKYSYYSNYYGYSNYYGEHKH              
                                              YSYYSNYYGYSNYY                   
© 1998-2019