BYKdb

Annotate results for A0A1C6ASN0

A0A1C6ASN0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6ASN0
DOMAINcd52/244TSCMPNEGKSSVAFNLAISLAESGKKVILLDCDLRKSVLVGRYKISKGVKGMTHYLTGMH
TIDQVICSTDVENLFVVFSGPVPPNPAELLGNRYFSALMKQLPEFYDYVIIDTPPLGSVI
DSAIVAQQCDGAVMVIAANQISYKFAQKTKEQLEKSNCKILGVVLNKVDIRENGYYGKYY
GKYYGKYYGKYYG
SITEWalker A59/61GKS
SITEWalker A'79/86ILLDCDLR
SITEWalker B160/166VIIDTPP
SITE-157/-159YDY
SITEY Cluster226/246YYGKYYGKYYGKYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQIDKSNFENNKVQKVSIREGTSLDYRTNEAYKSLRTNIQFCGDDIKTIAVTSCMPNEGKSSVAFNLAISLAESGKKVIL
                                                   TSCMPNEGKSSVAFNLAISLAESGKKVIL
                                                          GKS                 IL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDCDLRKSVLVGRYKISKGVKGMTHYLTGMHTIDQVICSTDVENLFVVFSGPVPPNPAELLGNRYFSALMKQLPEFYDYV
LDCDLRKSVLVGRYKISKGVKGMTHYLTGMHTIDQVICSTDVENLFVVFSGPVPPNPAELLGNRYFSALMKQLPEFYDYV
LDCDLR                                                                         V
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDTPPLGSVIDSAIVAQQCDGAVMVIAANQISYKFAQKTKEQLEKSNCKILGVVLNKVDIRENGYYGKYYGKYYGKYYG
IIDTPPLGSVIDSAIVAQQCDGAVMVIAANQISYKFAQKTKEQLEKSNCKILGVVLNKVDIRENGYYGKYYGKYYGKYYG
IIDTPP                                                           YYGKYYGKYYGKYYG
         
....:....
KYYGNYGSD
KYYG     
KYYGNY   
© 1998-2019