BYKdb

Annotate results for A0A1C6AUG1

A0A1C6AUG1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6AUG1
DOMAINcd40/229TSVEAGVGKSTIALSLAIAMAETGKTTLIIDNDFRNPQIANRLMVRGVYSLTELFSGKVD
PREACVPTKVNNLFMLDLGSRRLNNPIEVLSSGRYKALLAKVKQDFDFVVIDTPPLGLFI
DAAIASTQVDGVLMVISSGKSTAAEVKESLAQLEKANAHVIGCVLNNLKHKPADYYGYYY
DKRGDKKRKK
SITE-178/-180GKS
SITEWalker A'67/74LIIDNDFR
SITEWalker B148/154VVIDTPP
SITEY Cluster214/219YYGYYY
SITE-63/-65GKT
SITEWalker A47/49GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDNSYQIYFNSPELREAIKTLRVNIEFAGIDEPVRSVAVTSVEAGVGKSTIALSLAIAMAETGKTTLIIDNDFRNPQIAN
                                       TSVEAGVGKSTIALSLAIAMAETGKTTLIIDNDFRNPQIAN
                                              GKS                 LIIDNDFR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLMVRGVYSLTELFSGKVDPREACVPTKVNNLFMLDLGSRRLNNPIEVLSSGRYKALLAKVKQDFDFVVIDTPPLGLFID
RLMVRGVYSLTELFSGKVDPREACVPTKVNNLFMLDLGSRRLNNPIEVLSSGRYKALLAKVKQDFDFVVIDTPPLGLFID
                                                                   VVIDTPP      
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
AAIASTQVDGVLMVISSGKSTAAEVKESLAQLEKANAHVIGCVLNNLKHKPADYYGYYYDKRGDKKRKKIRRKQ
AAIASTQVDGVLMVISSGKSTAAEVKESLAQLEKANAHVIGCVLNNLKHKPADYYGYYYDKRGDKKRKK     
                                                     YYGYYY               
© 1998-2019