BYKdb

Annotate results for A0A1C6AXF3

A0A1C6AXF3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6AXF3
DOMAINcd40/229TSSKQNEGKSTVSANLAVSFAALEDKKVLIIDGDLRNPSVHKHFNISNAHGLTDIITGQK
TLQQTIQITGIDNLQILTTGKMPPNPAEMLESKKMKEFVDRLKEYYDYIFIDSPPIGIIT
DAGVIANYADATILVVGSKDVEAEVAKISKERLEKVKANVIGVVLNKYIGEGSSYGHYNY
YYEQSDGSRS
SITEWalker A47/49GKS
SITEWalker A'68/75LIIDGDLR
SITEWalker B148/154IFIDSPP
SITE-144/-147YYDY
SITEY Cluster214/221YGHYNYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MANVLAFKEPKSPIAEAYRTIRTNIQFSKIDKDIKTILVTSSKQNEGKSTVSANLAVSFAALEDKKVLIIDGDLRNPSVH
                                       TSSKQNEGKSTVSANLAVSFAALEDKKVLIIDGDLRNPSVH
                                              GKS                  LIIDGDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KHFNISNAHGLTDIITGQKTLQQTIQITGIDNLQILTTGKMPPNPAEMLESKKMKEFVDRLKEYYDYIFIDSPPIGIITD
KHFNISNAHGLTDIITGQKTLQQTIQITGIDNLQILTTGKMPPNPAEMLESKKMKEFVDRLKEYYDYIFIDSPPIGIITD
                                                                   IFIDSPP      
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
AGVIANYADATILVVGSKDVEAEVAKISKERLEKVKANVIGVVLNKYIGEGSSYGHYNYYYEQSDGSRSSKHKNKKRK
AGVIANYADATILVVGSKDVEAEVAKISKERLEKVKANVIGVVLNKYIGEGSSYGHYNYYYEQSDGSRS         
                                                     YGHYNYYY                 
© 1998-2019